Gene
Gene Model ID | pfu_aug1.0_12989.1_10543 |
---|---|
Locus | scaffold12989.1 : 12346 ... 13714 : + |
To GenomeBrowser | scaffold12989.1:12346..13714 |
Genes list of scaffold | scaffold12989.1 |
Synonym | pfu_aug2.0_3061.1_05738 |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-MyoRb |
Description | Best hit to Q7RTU0 RecName: Full=Transcription factor 24; Short=TCF-24 with 1e-29 by a BLASTP search against NCBI Homo sapiens nr database. This annotation is based on NJ, ML, and BI. |
mRNA evidence |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug1.0_12989.1_10543.t1 | 1 | 1 | HLH | 47 | 93 | 8.9e-12 | 44.5 | 8.6e-16 | 1.3e-11 | 44.0 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug1.0_12989.1_10543.t1 | gi|291240317|ref|XP_002740066.1| | PREDICTED: transcription factor 23-like [Saccoglossus kowalevskii] | 6.0e-23 |
Expression profile
(Color code: FPKM>10&<50, blue; FPKM>50, pink)Libraries | EST count |
---|---|
>Embryonic/Larval stages | |
mix | 2 |
egg-Dshape | 1 |
>Adult tissues | |
Dshape | 1 |
Transcript
Transcript ID | pfu_aug1.0_12989.1_10543.t1 |
---|---|
Definition | - |
>pfu_aug1.0_12989.1_10543.t1 atgggagactccgatgatgatttattttcgtttgcaacaacaaacgaactaccagaatacccgtttcaatttgagaacag taactttggaccggaaagaagttctccaaaatgtcgccaaacgatcatacccgggaacgcagcaagggagagaactcgag taaagacattacggggagcctttctagagttacaaaggactcttccggccgtccctccggacaccaagctgtccaagctg gacgttctagtactggccactacatatatagctcacctgatgcgcacgctgaacgagggagtggacgacaaccaactttt tgcagctcatgggataatgcatccagtaaaggtgtgtcatttttgtgtactaaatcattggtcttgttga |
Protein
Protein ID | pfu_aug1.0_12989.1_10543.t1 |
---|---|
Definition | - |
>pfu_aug1.0_12989.1_10543.t1 MGDSDDDLFSFATTNELPEYPFQFENSNFGPERSSPKCRQTIIPGNAARERTRVKTLRGAFLELQRTLPAVPPDTKLSKL DVLVLATTYIAHLMRTLNEGVDDNQLFAAHGIMHPVKVCHFCVLNHWSC |