Gene
Gene Model ID | pfu_aug1.0_13942.1_10662 |
---|---|
Locus | scaffold13942.1 : 15646 ... 27291 : + |
To GenomeBrowser | scaffold13942.1:15646..27291 |
Genes list of scaffold | scaffold13942.1 |
Synonym | NA |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-clock-related |
Description | Best hit to AEJ87226 clock [Platynereis dumerilii] with 1e-24 by BLASTP search against NCBI nr database. The predicted protein has a single PAS domain. We could not retrieve a bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
mRNA evidence |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug1.0_13942.1_10662.t1 | 1 | 1 | PAS | 31 | 78 | 1.3e-06 | 28.1 | 5.6e-10 | 1.7e-06 | 27.8 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug1.0_13942.1_10662.t1 | gi|157132927|ref|XP_001662706.1| | AAEL012562-PA [Aedes aegypti] | 3.0e-18 |
Transcript
Transcript ID | pfu_aug1.0_13942.1_10662.t1 |
---|---|
Definition | - |
>pfu_aug1.0_13942.1_10662.t1 atggtgtccacatctaacaagaagatggacaaatctactgtgctcaagtcaaccatcgccttccttaaaagttatcaagg taaatttaaggccatggacagcttccttctagtctttacccagcaaggaaccatattatatgtctcagaaagtgtaacct ccttgttgggtcatctaccgaatgatcttgtgaacgagcaagtttacgagtttatccatgaatcagagaaacagaatttg tacaatatgttataccactttagcatgtctaatgctgcagatcagatcaagg |
Protein
Protein ID | pfu_aug1.0_13942.1_10662.t1 |
---|---|
Definition | - |
>pfu_aug1.0_13942.1_10662.t1 MVSTSNKKMDKSTVLKSTIAFLKSYQGKFKAMDSFLLVFTQQGTILYVSESVTSLLGHLPNDLVNEQVYEFIHESEKQNL YNMLYHFSMSNAADQIK |