Gene
Gene Model ID | pfu_aug1.0_25206.1_11676 |
---|---|
Locus | scaffold25206.1 : 14138 ... 23095 : - |
To GenomeBrowser | scaffold25206.1:14138..23095 |
Genes list of scaffold | scaffold25206.1 |
Synonym | pfu_aug2.0_224.1_13818 |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-Hairy_orange domain containing 3 |
Description | Best hit to NP_001161564 hey-like transcription factor [Saccoglossus kowalevskii] with 3e-14 by a BLASTP search against NCBI nr. We could not retrieve a bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
mRNA evidence |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug1.0_25206.1_11676.t1 | 2 | 1 | Hairy_orange | 78 | 117 | 2.5e-08 | 33.5 | 7.5e-12 | 5.5e-08 | 32.4 |
pfu_aug1.0_25206.1_11676.t1 | 2 | 2 | Hairy_orange | 130 | 137 | 2.5e-08 | 33.5 | 0.76 | 5600.0 | -2.9 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
pfu_aug1.0_25206.1_11676.t1 | gi|269785273|ref|NP_001161564.1| | hey-like transcription factor [Saccoglossus kowalevskii] | 2.0e-12 |
Transcript
Transcript ID | pfu_aug1.0_25206.1_11676.t1 |
---|---|
Definition | - |
>pfu_aug1.0_25206.1_11676.t1 atgcatagttactaccattacgacctggggtttatgatttttttcttaaaaggagagtggatcgcatatttacattttgc atacgtgataacgtcaatcgactgtttacaatctgaaactactcctttgtatgtatatgaagcaagaaagaaatcttttg agacaatatacacaactatttctgtaggagactggtttagcacagacatatggacggacttcatgcatcactataaggtc ggctacaacgactgcatccgggaaatccagaggttcatgactgacgtggagggtgtcaacgcagatgacgatagatgcat ccggttaatttcctatttgcagacgagattcagaccagattcttctatcagtggtggcgctgcttaccgcgaggcgctag aacgtctgagcagtcacatactaacaacttaa |
Protein
Protein ID | pfu_aug1.0_25206.1_11676.t1 |
---|---|
Definition | - |
>pfu_aug1.0_25206.1_11676.t1 MHSYYHYDLGFMIFFLKGEWIAYLHFAYVITSIDCLQSETTPLYVYEARKKSFETIYTTISVGDWFSTDIWTDFMHHYKV GYNDCIREIQRFMTDVEGVNADDDRCIRLISYLQTRFRPDSSISGGAAYREALERLSSHILTT |