Gene
Gene Model ID | pfu_aug1.0_85306.1_49342 |
---|---|
Locus | scaffold85306.1 : 1 ... 2015 : - |
To GenomeBrowser | scaffold85306.1:1..2015 |
Genes list of scaffold | scaffold85306.1 |
Synonym | NA |
Manual annotation
Study field | Transcription Factors |
---|---|
Gene name | Pfu-Hif-related2 |
Description | Best hit to BAG65259 unnamed protein product [Homo sapiens] with 1e-20 by a BLASTP search against NCBI Homo sapiens nr database. We could not retrieve a bHLH domain, and therefore this gene is not included in the bHLH annotation paper. |
mRNA evidence |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
pfu_aug1.0_85306.1_49342.t1 | 1 | 1 | PAS_11 | 14 | 63 | 2.0e-08 | 34.1 | 2.9e-12 | 2.1e-08 | 34.0 |
pfu_aug1.0_85306.1_49342.t1 | 1 | 1 | PAS_3 | 16 | 60 | 4.3e-07 | 29.9 | 6.3e-11 | 4.7e-07 | 29.8 |
Transcript
Transcript ID | pfu_aug1.0_85306.1_49342.t1 |
---|---|
Definition | - |
>pfu_aug1.0_85306.1_49342.t1 atgggtaatttatattttgaccttgaccttgaagctgacgcagtgttttccaaaggccagacaatgacaggacagtaccg cttcttggcccgtggaggaggatatgtgtgggtggtgacccagggcacagtcatcactaacagccgcacccagaaacctc agtgtgtagtctgcgttcactacgtcatcag |
Protein
Protein ID | pfu_aug1.0_85306.1_49342.t1 |
---|---|
Definition | - |
>pfu_aug1.0_85306.1_49342.t1 MGNLYFDLDLEADAVFSKGQTMTGQYRFLARGGGYVWVVTQGTVITNSRTQKPQCVVCVHYVI |