Gene
| Gene Model ID | aacu_s0062.g32 |
|---|---|
| Locus | sc0000062 : 855000 ... 859159 : - |
| To GenomeBrowser | sc0000062:855000..859159 |
| Genes list of scaffold | sc0000062 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| aacu_s0062.g32.t1 | 1 | 1 | AAA_30 | 2 | 124 | 3.7e-06 | 26.7 | 2.0e-08 | 6.7e-06 | 25.8 |
| aacu_s0062.g32.t1 | 1 | 1 | AAA_16 | 3 | 44 | 5.8e-06 | 26.7 | 3.7e-08 | 1.3e-05 | 25.6 |
| aacu_s0062.g32.t1 | 1 | 1 | AAA_22 | 4 | 138 | 2.9e-06 | 27.5 | 2.7e-08 | 9.2e-06 | 25.8 |
| aacu_s0062.g32.t1 | 1 | 1 | NTPase_1 | 8 | 173 | 0.0 | 167.5 | 0.0 | 0.0 | 167.3 |
Results of InterPro Scan
| Gene Model ID | Analysis | Start | End | i_acc | i_desc | GO | Pathway |
|---|---|---|---|---|---|---|---|
| aacu_s0062.g32.t1 | Gene3D | 1 | 173 | ||||
| aacu_s0062.g32.t1 | PANTHER | 3 | 173 | ||||
| aacu_s0062.g32.t1 | CDD | 3 | 74 | ||||
| aacu_s0062.g32.t1 | SMART | 5 | 172 | IPR003593 | AAA+ ATPase domain | ||
| aacu_s0062.g32.t1 | SUPERFAMILY | 7 | 173 | IPR027417 | P-loop containing nucleosid... | ||
| aacu_s0062.g32.t1 | Pfam | 8 | 173 | IPR004948 | Nucleoside-triphosphatase, ... | GO:0098519 | KEGG: 00230+3.6.1.15|KEGG: 00730+3.6.1.15|MetaCyc: PWY-6545|MetaCyc: PWY-7184|MetaCyc: PWY-7198|MetaCyc: PWY-7210 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| aacu_s0062.g32.t1 | sp|Q1LZ78|NTPCR_BOVIN | Cancer-related nucleoside-triphosphatase homolog | 0.0 |
| aacu_s0062.g32.t1 | sp|Q9BSD7|NTPCR_HUMAN | Cancer-related nucleoside-triphosphatase | 0.0 |
| aacu_s0062.g32.t1 | sp|Q9CQA9|NTPCR_MOUSE | Cancer-related nucleoside-triphosphatase homolog | 0.0 |
| aacu_s0062.g32.t1 | sp|B1LAB2|NTPTH_THESQ | Nucleoside-triphosphatase THEP1 | 7.0e-30 |
| aacu_s0062.g32.t1 | sp|Q9WXP3|NTPTH_THEMA | Nucleoside-triphosphatase THEP1 | 1.0e-29 |
Transcript
| Transcript ID | aacu_s0062.g32.t1 |
|---|---|
| Definition | - |
>aacu_s0062.g32.t1 cggttgcaattcaaagatggcgtcaagcagcaaaagacatgttctgttgactggatctcccggagttggaaagacaactt tgtgtcaaaagctttttggagttcttaaagagaaaggaatccagatacaaggattctacacagaagaggtccgcaccagt cccaaggggagtagagtgggctttgatgttgtcacactaaatggacagcgaggagtactggcaagaataaaaggtgactc tcgcacatcaagaggaaggacatcaccttcagtgggaaactacatggttgacgtgaagtcatttgaacaacttgctctcc caacaatcaagatttcttcagtcagtaacacagtggttgtggttgatgaaattggaaaaatggaactgttcagtcaaagc tttgtcaatttagtccgtgagctttttgcttcgccacaagccactattttagccaccgtcccaatcactaaacagcgacc cattccatttgtggatgagctcaaatgtcgggaagatgttactttaatagaggtaaagtaatgcagagaacaggttcctg aattccttgtcagctcactttcagaaaggggtcatttgtcttggccatgcctggtcctcgagaaaatagagtgagtgcca tttt |
|
Protein
| Protein ID | aacu_s0062.g32.t1 |
|---|---|
| Definition | - |
>aacu_s0062.g32.t1 MASSSKRHVLLTGSPGVGKTTLCQKLFGVLKEKGIQIQGFYTEEVRTSPKGSRVGFDVVTLNGQRGVLARIKGDSRTSRG RTSPSVGNYMVDVKSFEQLALPTIKISSVSNTVVVVDEIGKMELFSQSFVNLVRELFASPQATILATVPITKQRPIPFVD ELKCREDVTLIEVK |
|