Gene
Gene Model ID | ahya_s0011.g184 |
---|---|
Locus | sc0000011 : 3870469 ... 3875840 : - |
To GenomeBrowser | sc0000011:3870469..3875840 |
Genes list of scaffold | sc0000011 |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
ahya_s0011.g184.t1 | 4 | 1 | Ank_2 | 39 | 125 | 0.0 | 162.3 | 6.7e-17 | 1.8e-13 | 50.7 |
ahya_s0011.g184.t1 | 6 | 1 | Ank_4 | 39 | 86 | 1.7e-40 | 136.7 | 1.3e-08 | 3.7e-05 | 24.1 |
ahya_s0011.g184.t1 | 5 | 1 | Ank_5 | 57 | 100 | 3.9e-29 | 100.1 | 1.1e-07 | 0.0003 | 20.9 |
ahya_s0011.g184.t1 | 5 | 1 | Ank_3 | 66 | 93 | 1.8e-39 | 129.1 | 5.8e-06 | 0.016 | 15.6 |
ahya_s0011.g184.t1 | 4 | 1 | Ank | 66 | 96 | 2.5e-38 | 128.9 | 9.7e-07 | 0.0026 | 18.1 |
ahya_s0011.g184.t1 | 6 | 2 | Ank_4 | 79 | 119 | 1.7e-40 | 136.7 | 5.4e-08 | 0.00015 | 22.1 |
ahya_s0011.g184.t1 | 6 | 3 | Ank_4 | 102 | 152 | 1.7e-40 | 136.7 | 8.0e-10 | 2.2e-06 | 28.0 |
ahya_s0011.g184.t1 | 5 | 2 | Ank_3 | 102 | 122 | 1.8e-39 | 129.1 | 5.6e-07 | 0.0015 | 18.7 |
ahya_s0011.g184.t1 | 4 | 2 | Ank | 102 | 125 | 2.5e-38 | 128.9 | 7.8e-08 | 0.00021 | 21.5 |
ahya_s0011.g184.t1 | 5 | 2 | Ank_5 | 102 | 136 | 3.9e-29 | 100.1 | 6.5e-08 | 0.00018 | 21.7 |
ahya_s0011.g184.t1 | 4 | 2 | Ank_2 | 103 | 190 | 0.0 | 162.3 | 2.7e-19 | 7.3e-16 | 58.4 |
ahya_s0011.g184.t1 | 5 | 3 | Ank_5 | 151 | 191 | 3.9e-29 | 100.1 | 5.9e-07 | 0.0016 | 18.6 |
ahya_s0011.g184.t1 | 5 | 3 | Ank_3 | 163 | 190 | 1.8e-39 | 129.1 | 1.6e-06 | 0.0043 | 17.3 |
ahya_s0011.g184.t1 | 6 | 4 | Ank_4 | 164 | 220 | 1.7e-40 | 136.7 | 1.9e-12 | 5.1e-09 | 36.4 |
ahya_s0011.g184.t1 | 4 | 3 | Ank_2 | 200 | 260 | 0.0 | 162.3 | 2.3e-16 | 6.1e-13 | 49.0 |
ahya_s0011.g184.t1 | 5 | 4 | Ank_3 | 201 | 227 | 1.8e-39 | 129.1 | 8.1e-09 | 2.2e-05 | 24.3 |
ahya_s0011.g184.t1 | 4 | 3 | Ank | 201 | 230 | 2.5e-38 | 128.9 | 2.2e-09 | 5.8e-06 | 26.5 |
ahya_s0011.g184.t1 | 6 | 5 | Ank_4 | 202 | 253 | 1.7e-40 | 136.7 | 9.3e-15 | 2.5e-11 | 43.7 |
ahya_s0011.g184.t1 | 5 | 4 | Ank_5 | 202 | 240 | 3.9e-29 | 100.1 | 7.8e-09 | 2.1e-05 | 24.6 |
ahya_s0011.g184.t1 | 5 | 5 | Ank_5 | 219 | 258 | 3.9e-29 | 100.1 | 7.6e-06 | 0.021 | 15.1 |
ahya_s0011.g184.t1 | 5 | 5 | Ank_3 | 233 | 258 | 1.8e-39 | 129.1 | 4.6e-06 | 0.012 | 15.9 |
ahya_s0011.g184.t1 | 4 | 4 | Ank | 233 | 262 | 2.5e-38 | 128.9 | 1.3e-08 | 3.6e-05 | 23.9 |
ahya_s0011.g184.t1 | 6 | 6 | Ank_4 | 266 | 313 | 1.7e-40 | 136.7 | 9.0e-07 | 0.0025 | 18.2 |
ahya_s0011.g184.t1 | 4 | 4 | Ank_2 | 270 | 359 | 0.0 | 162.3 | 3.6e-07 | 0.00097 | 19.5 |
ahya_s0011.g184.t1 | 1 | 1 | SOCS_box | 363 | 399 | 8.2e-08 | 32.3 | 7.1e-11 | 1.9e-07 | 31.1 |
Results of InterPro Scan
Gene Model ID | Analysis | Start | End | i_acc | i_desc | GO | Pathway |
---|---|---|---|---|---|---|---|
ahya_s0011.g184.t1 | Gene3D | 22 | 112 | IPR036770 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | SUPERFAMILY | 31 | 356 | IPR036770 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | ProSiteProfiles | 31 | 344 | IPR020683 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | Pfam | 39 | 86 | ||||
ahya_s0011.g184.t1 | ProSiteProfiles | 65 | 97 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | SMART | 65 | 94 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | CDD | 66 | 183 | IPR020683 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | ProSiteProfiles | 98 | 130 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | SMART | 98 | 130 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | Pfam | 103 | 190 | IPR020683 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | Gene3D | 113 | 145 | IPR036770 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | SMART | 131 | 161 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | ProSiteProfiles | 131 | 163 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | Gene3D | 146 | 197 | IPR036770 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | CDD | 158 | 286 | IPR020683 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | SMART | 162 | 191 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | ProSiteProfiles | 162 | 194 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | Gene3D | 198 | 269 | IPR036770 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | ProSiteProfiles | 199 | 231 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | SMART | 199 | 228 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | Pfam | 201 | 260 | IPR020683 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | CDD | 227 | 356 | IPR020683 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | ProSiteProfiles | 232 | 264 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | SMART | 232 | 261 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | ProSiteProfiles | 265 | 297 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | SMART | 265 | 294 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | Gene3D | 270 | 394 | IPR036770 | Ankyrin repeat-containing d... | ||
ahya_s0011.g184.t1 | SMART | 298 | 332 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | Pfam | 300 | 332 | IPR002110 | Ankyrin repeat | GO:0005515 | |
ahya_s0011.g184.t1 | Pfam | 363 | 399 | IPR001496 | SOCS box domain | Reactome: R-HSA-8951664 | |
ahya_s0011.g184.t1 | ProSiteProfiles | 363 | 402 | IPR001496 | SOCS box domain | Reactome: R-HSA-8951664 | |
ahya_s0011.g184.t1 | SMART | 363 | 401 | IPR001496 | SOCS box domain | Reactome: R-HSA-8951664 |
Transcript
Transcript ID | ahya_s0011.g184.t1 |
---|---|
Definition | - |
>ahya_s0011.g184.t1 tcgcacagtaaccaatgaaatcacgcggaagctaaattggtgggtcacaagagtacatacaacgcaaaaccacattcgac ttgtgaacttcaccgtttatccagcatcgttgaaggacaaaagtcctcttaaaatacaaaaacaacaagttaaaaaacaa aatcagacaatcaacgcaaaatgtgaccctgtaatctgaataacccacttgactttgaaaccaggccctcagcgtatctc taaggaaaatttgaagatggaagaagataatttatttgatgaagtctttcggccaactcctcggagatctcgcccactca gtgttattctctccaatccgagggaaaatggagtgaaagagtttttggatgcagtgcaagaagggcgtcttgatgatgcc aaggtcatttttgaagtcaagaaaatagatcccaatgttagtcgtagaggaggagaaactgcattgcatacatgtacagc aaatggacagctagaattttgcaagttcctccttgaagtaggatctaatgtaaatcaaaaagatggacgcttaaagattc cccttcacttagcttgttcaaatggccatttggatattgtgaaggtgcttgttcagggtggttctagcttaggcgacatt gacaaacttggaagatcgcctcttctatgggcaacagctggtggatttgtggaagctgtgaagttcttacttgaagcagg agcgcctgcaaaatctaatagaaattggcatgctcttcatgaagcctgcaaagtgggttctgttgagttggtgcaaatct tgataaatgcgggggcacctgtaaataatccagagcaatattctggtggtgctccttggtctcctcttcatattgctgtg cgccatggtaatctagactgcatcaaagtgctcatcagagctggtgctaatgtgaacagtatcaatgctgggggacacac tcctttgcatgaagctgcatacagaggatacgaggatacaataaagatgcttctattacatggagcaaaccatcatgcgg caagtaaccagaggaggacacctttacatgaagcttgcatgcagggcaaagtaacatctgcagtaatattgttggatgtt tgcagtgaagtaaatgctgtagatttagtaagagacactcctctccatttggcccttagagccaaccatgcctatgatat tgctgtccagttaacttctacactcctgagatacggtgcatcgccaactcttcttggccgagatgatgacatgccaattg atgtagctaagcaaacttatcaggattactgcttagaattgttagaggatgccttggaaataccccagcctcttactcaa ctttgcaaaatttctgtgaggagacaattagcttatcattgggagagtattagtgaacttcctctgccattaacgttgaa gactttcattaaaagtgctgtttgatgatttgtgaacaatcatcacaaagatttttacaatcaaattttgatatggcagt cttcaagataatctttggtacaatttttatttgtaactatttatttcatctctcaaactctgcatttcctgtgttttctc tttcaataattgttacttttttatttataaggtctgattgtttgatgcggcaataaggagcttaaacatgcaacaatttt tttttagccatggaatacaaccataagtgagctgttttcctatgaacatgtctttacactacacatttatatttttaatt atcttttcactagaaggcaggatttgtttaaatgtgggaaaggccactgccatggaatgctaaatgttcacttctggttt tctcataatataggtcagtgtttccttgcagaaagattctgtgtagcgtacagaacttatctcaaactcagaataacagc tgattaaaata |
Protein
Protein ID | ahya_s0011.g184.t1 |
---|---|
Definition | - |
>ahya_s0011.g184.t1 MEEDNLFDEVFRPTPRRSRPLSVILSNPRENGVKEFLDAVQEGRLDDAKVIFEVKKIDPNVSRRGGETALHTCTANGQLE FCKFLLEVGSNVNQKDGRLKIPLHLACSNGHLDIVKVLVQGGSSLGDIDKLGRSPLLWATAGGFVEAVKFLLEAGAPAKS NRNWHALHEACKVGSVELVQILINAGAPVNNPEQYSGGAPWSPLHIAVRHGNLDCIKVLIRAGANVNSINAGGHTPLHEA AYRGYEDTIKMLLLHGANHHAASNQRRTPLHEACMQGKVTSAVILLDVCSEVNAVDLVRDTPLHLALRANHAYDIAVQLT STLLRYGASPTLLGRDDDMPIDVAKQTYQDYCLELLEDALEIPQPLTQLCKISVRRQLAYHWESISELPLPLTLKTFIKS AV |