Gene
| Gene Model ID | ahya_s0011.g201 |
|---|---|
| Locus | sc0000011 : 3999959 ... 4002957 : + |
| To GenomeBrowser | sc0000011:3999959..4002957 |
| Genes list of scaffold | sc0000011 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| ahya_s0011.g201.t1 | 2 | 1 | TPR_12 | 93 | 164 | 7.5e-16 | 58.1 | 1.0e-12 | 1.3e-09 | 38.1 |
| ahya_s0011.g201.t1 | 2 | 1 | TPR_1 | 93 | 116 | 1.5e-15 | 56.2 | 9.7e-06 | 0.012 | 15.3 |
| ahya_s0011.g201.t1 | 2 | 2 | TPR_1 | 133 | 160 | 1.5e-15 | 56.2 | 1.5e-08 | 1.9e-05 | 24.1 |
| ahya_s0011.g201.t1 | 1 | 1 | TPR_2 | 133 | 163 | 1.5e-13 | 49.6 | 3.7e-08 | 4.7e-05 | 23.1 |
| ahya_s0011.g201.t1 | 1 | 1 | TPR_8 | 133 | 163 | 5.3e-09 | 35.5 | 1.0e-08 | 1.3e-05 | 24.9 |
| ahya_s0011.g201.t1 | 1 | 1 | TPR_10 | 133 | 165 | 6.3e-08 | 32.1 | 1.3e-07 | 0.00016 | 21.3 |
| ahya_s0011.g201.t1 | 1 | 1 | TPR_7 | 134 | 164 | 9.4e-14 | 50.2 | 8.6e-10 | 1.1e-06 | 28.1 |
| ahya_s0011.g201.t1 | 2 | 2 | TPR_12 | 175 | 237 | 7.5e-16 | 58.1 | 6.5e-07 | 0.00082 | 19.5 |
Results of InterPro Scan
| Gene Model ID | Analysis | Start | End | i_acc | i_desc | GO | Pathway |
|---|---|---|---|---|---|---|---|
| ahya_s0011.g201.t1 | PANTHER | 62 | 236 | ||||
| ahya_s0011.g201.t1 | Coils | 66 | 86 | ||||
| ahya_s0011.g201.t1 | Gene3D | 69 | 141 | ||||
| ahya_s0011.g201.t1 | SUPERFAMILY | 86 | 246 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g201.t1 | SMART | 91 | 124 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g201.t1 | ProSiteProfiles | 91 | 124 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g201.t1 | ProSiteProfiles | 91 | 165 | IPR013026 | Tetratricopeptide repeat-co... | GO:0005515 | |
| ahya_s0011.g201.t1 | Pfam | 93 | 164 | ||||
| ahya_s0011.g201.t1 | SMART | 132 | 165 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g201.t1 | ProSiteProfiles | 132 | 165 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g201.t1 | Gene3D | 142 | 183 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g201.t1 | SMART | 172 | 205 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g201.t1 | Gene3D | 184 | 254 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g201.t1 | SMART | 212 | 245 | IPR019734 | Tetratricopeptide repeat | GO:0005515 |
Transcript
| Transcript ID | ahya_s0011.g201.t1 |
|---|---|
| Definition | - |
>ahya_s0011.g201.t1 ctaaattatagtacctttcatgagaatgtcaaatgaacatgggttctagcctttgtgccaaatttcgtaactggagaaaa cttcgctcgaaaggaagaaaaatcaaggaggatgcaatgccatttaatgtcaacgaggagaatgaagaggaagtagccgt agaaaaaggaaagttgaggaggatcatttgccacgaggaagaagacgatgaaatgaaaccagttttgtacgcaaaacagg aattggaaaatttgatagttgagttagagaaagagcttaaggctaaccggtgcaacaaacgcaagagagaaaaattgttg ttagaacttggacatgcctattataaatactgtaaatttgaaaaggcacggcatcactatgaacaacattttaatctcgt ccgcaaacgaatacactctctgtccagcttgcaaagagcttactgcaaccttggatgcgtttatagaaggcttggtgatt tcgacaaggcagccagttttttagaaactggcttagcgatggctgaggaagcacaagatttgagatcccagggaaggttt tacaacaatcttggaaacatctgtgagatgcagagggattttgagggcgcaattttttatcattgcaagagaaggaaaat cgctgagatcttaaaagatggcgacagtgaagcgaaagctagtgcaagcatcgcaaatgcatatcactgcattggaaatt taagaagaagcataacctattatgaaagcgtcgtgctttggttgaagagaaagttagtgtatcaagagcgacagagaagt agattggctcgtatatcacagctacctactgaaaatgagcaatgggtctaatgatctgatgcctttggggtacaaacagt ctcacaggattttgtcttaagtgtttttgtctaaaatttgatgaataaaaaagcatttgcaaa |
|
Protein
| Protein ID | ahya_s0011.g201.t1 |
|---|---|
| Definition | - |
>ahya_s0011.g201.t1 MGSSLCAKFRNWRKLRSKGRKIKEDAMPFNVNEENEEEVAVEKGKLRRIICHEEEDDEMKPVLYAKQELENLIVELEKEL KANRCNKRKREKLLLELGHAYYKYCKFEKARHHYEQHFNLVRKRIHSLSSLQRAYCNLGCVYRRLGDFDKAASFLETGLA MAEEAQDLRSQGRFYNNLGNICEMQRDFEGAIFYHCKRRKIAEILKDGDSEAKASASIANAYHCIGNLRRSITYYESVVL WLKRKLVYQERQRSRLARISQLPTENEQWV |
|