Gene
| Gene Model ID | ahya_s0011.g249 |
|---|---|
| Locus | sc0000011 : 4639771 ... 4643282 : - |
| To GenomeBrowser | sc0000011:4639771..4643282 |
| Genes list of scaffold | sc0000011 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| ahya_s0011.g249.t1 | 1 | 1 | F5_F8_type_C | 18 | 98 | 1.4e-16 | 60.6 | 9.7e-21 | 1.6e-16 | 60.5 |
Results of InterPro Scan
| Gene Model ID | Analysis | Start | End | i_acc | i_desc | GO | Pathway |
|---|---|---|---|---|---|---|---|
| ahya_s0011.g249.t1 | Gene3D | 1 | 105 | IPR008979 | Galactose-binding-like doma... | ||
| ahya_s0011.g249.t1 | ProSiteProfiles | 1 | 106 | IPR000421 | Coagulation factor 5/8 C-te... | ||
| ahya_s0011.g249.t1 | PANTHER | 4 | 97 | ||||
| ahya_s0011.g249.t1 | PANTHER | 4 | 97 | ||||
| ahya_s0011.g249.t1 | SUPERFAMILY | 8 | 99 | IPR008979 | Galactose-binding-like doma... | ||
| ahya_s0011.g249.t1 | Pfam | 18 | 98 | IPR000421 | Coagulation factor 5/8 C-te... | ||
| ahya_s0011.g249.t1 | ProSitePatterns | 38 | 68 | IPR000421 | Coagulation factor 5/8 C-te... |
Transcript
| Transcript ID | ahya_s0011.g249.t1 |
|---|---|
| Definition | - |
>ahya_s0011.g249.t1 tattccgttcggcaagttcccagtggagtgacagcctgcagaatgaattcagttggagtttcagatagttccattattta tgatcagagattttcagcttcctcatgtttaagcagtggctgtgcttctaatgggcgtctgaatggaagcagtgcctgga tacccagcagtaacaataataacaatgactacctacagattgatctcggatctgtgtatgttgtttgtgctgtggctact cagggaaacccaagtgcagatgattggacaaaaacatacaaaataaaaacctctttggataacgtgaagtggcagtggta tcaggaaaataatataactaaggaacaaagcattaagagttgaagtttttggatccaagcaaggctgcttgtcatcagtt ggcaatgaacaaggtgttccatc |
|
Protein
| Protein ID | ahya_s0011.g249.t1 |
|---|---|
| Definition | - |
>ahya_s0011.g249.t1 MNSVGVSDSSIIYDQRFSASSCLSSGCASNGRLNGSSAWIPSSNNNNNDYLQIDLGSVYVVCAVATQGNPSADDWTKTYK IKTSLDNVKWQWYQENNITKEQSIKS |
|