Gene
Gene Model ID | ahya_s0011.g37 |
---|---|
Locus | sc0000011 : 714527 ... 762470 : - |
To GenomeBrowser | sc0000011:714527..762470 |
Genes list of scaffold | sc0000011 |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
ahya_s0011.g37.t1 | 7 | 1 | TPR_12 | 40 | 80 | 0.0 | 241.0 | 1.6e-06 | 0.0011 | 19.1 |
ahya_s0011.g37.t1 | 7 | 2 | TPR_12 | 49 | 119 | 0.0 | 241.0 | 2.2e-13 | 1.5e-10 | 41.1 |
ahya_s0011.g37.t1 | 10 | 1 | TPR_7 | 56 | 84 | 0.0 | 235.6 | 4.2e-06 | 0.0028 | 17.4 |
ahya_s0011.g37.t1 | 7 | 3 | TPR_12 | 89 | 158 | 0.0 | 241.0 | 6.5e-15 | 4.4e-12 | 46.0 |
ahya_s0011.g37.t1 | 9 | 1 | TPR_1 | 89 | 113 | 0.0 | 188.4 | 5.7e-06 | 0.0039 | 16.8 |
ahya_s0011.g37.t1 | 5 | 1 | TPR_8 | 89 | 119 | 9.8e-39 | 128.2 | 5.1e-06 | 0.0035 | 17.3 |
ahya_s0011.g37.t1 | 1 | 1 | TPR_2 | 89 | 119 | 1.9e-29 | 99.2 | 1.4e-06 | 0.00094 | 19.0 |
ahya_s0011.g37.t1 | 10 | 2 | TPR_7 | 90 | 124 | 0.0 | 235.6 | 1.8e-06 | 0.0012 | 18.6 |
ahya_s0011.g37.t1 | 9 | 2 | TPR_1 | 129 | 157 | 0.0 | 188.4 | 9.5e-07 | 0.00065 | 19.3 |
ahya_s0011.g37.t1 | 10 | 3 | TPR_7 | 131 | 164 | 0.0 | 235.6 | 1.6e-06 | 0.0011 | 18.7 |
ahya_s0011.g37.t1 | 10 | 4 | TPR_7 | 170 | 204 | 0.0 | 235.6 | 6.9e-08 | 4.7e-05 | 23.0 |
ahya_s0011.g37.t1 | 7 | 4 | TPR_12 | 170 | 233 | 0.0 | 241.0 | 1.4e-13 | 9.5e-11 | 41.7 |
ahya_s0011.g37.t1 | 9 | 3 | TPR_1 | 170 | 197 | 0.0 | 188.4 | 7.0e-07 | 0.00048 | 19.7 |
ahya_s0011.g37.t1 | 10 | 5 | TPR_7 | 210 | 234 | 0.0 | 235.6 | 8.7e-08 | 5.9e-05 | 22.7 |
ahya_s0011.g37.t1 | 9 | 4 | TPR_1 | 210 | 233 | 0.0 | 188.4 | 1.5e-07 | 9.9e-05 | 21.9 |
ahya_s0011.g37.t1 | 7 | 5 | TPR_12 | 249 | 318 | 0.0 | 241.0 | 2.6e-18 | 1.7e-15 | 56.9 |
ahya_s0011.g37.t1 | 9 | 5 | TPR_1 | 249 | 270 | 0.0 | 188.4 | 1.4e-08 | 9.4e-06 | 25.1 |
ahya_s0011.g37.t1 | 5 | 2 | TPR_8 | 249 | 273 | 9.8e-39 | 128.2 | 1.1e-06 | 0.00075 | 19.4 |
ahya_s0011.g37.t1 | 10 | 6 | TPR_7 | 250 | 283 | 0.0 | 235.6 | 4.1e-09 | 2.8e-06 | 26.8 |
ahya_s0011.g37.t1 | 9 | 6 | TPR_1 | 289 | 317 | 0.0 | 188.4 | 1.2e-10 | 8.0e-08 | 31.7 |
ahya_s0011.g37.t1 | 5 | 3 | TPR_8 | 289 | 317 | 9.8e-39 | 128.2 | 5.7e-07 | 0.00038 | 20.3 |
ahya_s0011.g37.t1 | 10 | 7 | TPR_7 | 290 | 318 | 0.0 | 235.6 | 5.8e-10 | 3.9e-07 | 29.5 |
ahya_s0011.g37.t1 | 10 | 8 | TPR_7 | 330 | 364 | 0.0 | 235.6 | 3.1e-10 | 2.1e-07 | 30.3 |
ahya_s0011.g37.t1 | 7 | 6 | TPR_12 | 330 | 398 | 0.0 | 241.0 | 1.4e-16 | 9.7e-14 | 51.3 |
ahya_s0011.g37.t1 | 9 | 7 | TPR_1 | 330 | 357 | 0.0 | 188.4 | 3.1e-09 | 2.1e-06 | 27.2 |
ahya_s0011.g37.t1 | 5 | 4 | TPR_8 | 330 | 357 | 9.8e-39 | 128.2 | 2.3e-06 | 0.0015 | 18.4 |
ahya_s0011.g37.t1 | 9 | 8 | TPR_1 | 369 | 393 | 0.0 | 188.4 | 4.6e-08 | 3.1e-05 | 23.5 |
ahya_s0011.g37.t1 | 5 | 5 | TPR_8 | 369 | 398 | 9.8e-39 | 128.2 | 1.3e-07 | 9.0e-05 | 22.3 |
ahya_s0011.g37.t1 | 10 | 9 | TPR_7 | 370 | 404 | 0.0 | 235.6 | 7.7e-10 | 5.2e-07 | 29.1 |
ahya_s0011.g37.t1 | 9 | 9 | TPR_1 | 409 | 433 | 0.0 | 188.4 | 8.3e-07 | 0.00056 | 19.5 |
ahya_s0011.g37.t1 | 10 | 10 | TPR_7 | 410 | 444 | 0.0 | 235.6 | 3.3e-07 | 0.00022 | 20.9 |
ahya_s0011.g37.t1 | 7 | 7 | TPR_12 | 411 | 469 | 0.0 | 241.0 | 1.4e-11 | 9.6e-09 | 35.3 |
ahya_s0011.g37.t1 | 1 | 1 | CHAT | 657 | 924 | 0.0 | 192.4 | 0.0 | 0.0 | 192.0 |
Results of InterPro Scan
Gene Model ID | Analysis | Start | End | i_acc | i_desc | GO | Pathway |
---|---|---|---|---|---|---|---|
ahya_s0011.g37.t1 | Gene3D | 24 | 90 | ||||
ahya_s0011.g37.t1 | PANTHER | 31 | 131 | ||||
ahya_s0011.g37.t1 | PANTHER | 31 | 131 | ||||
ahya_s0011.g37.t1 | SUPERFAMILY | 32 | 181 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
ahya_s0011.g37.t1 | SMART | 48 | 81 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 48 | 81 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 48 | 481 | IPR013026 | Tetratricopeptide repeat-co... | GO:0005515 | |
ahya_s0011.g37.t1 | Pfam | 54 | 84 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | SMART | 88 | 121 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 88 | 121 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | Pfam | 89 | 158 | ||||
ahya_s0011.g37.t1 | Gene3D | 91 | 131 | ||||
ahya_s0011.g37.t1 | PANTHER | 122 | 331 | ||||
ahya_s0011.g37.t1 | PANTHER | 122 | 331 | ||||
ahya_s0011.g37.t1 | SMART | 128 | 161 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 128 | 161 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | Gene3D | 132 | 178 | ||||
ahya_s0011.g37.t1 | SUPERFAMILY | 165 | 323 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
ahya_s0011.g37.t1 | SMART | 168 | 201 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 168 | 201 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | Pfam | 170 | 233 | ||||
ahya_s0011.g37.t1 | Gene3D | 179 | 218 | ||||
ahya_s0011.g37.t1 | SMART | 208 | 241 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 208 | 241 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | Gene3D | 219 | 256 | ||||
ahya_s0011.g37.t1 | ProSiteProfiles | 248 | 281 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | SMART | 248 | 281 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | Pfam | 249 | 318 | ||||
ahya_s0011.g37.t1 | Gene3D | 257 | 295 | ||||
ahya_s0011.g37.t1 | PANTHER | 275 | 461 | ||||
ahya_s0011.g37.t1 | PANTHER | 275 | 461 | ||||
ahya_s0011.g37.t1 | SMART | 288 | 321 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 288 | 321 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | SUPERFAMILY | 289 | 488 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
ahya_s0011.g37.t1 | Gene3D | 296 | 336 | ||||
ahya_s0011.g37.t1 | SMART | 328 | 361 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 328 | 361 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | Pfam | 330 | 398 | ||||
ahya_s0011.g37.t1 | Gene3D | 337 | 371 | ||||
ahya_s0011.g37.t1 | SMART | 368 | 401 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 368 | 401 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | Gene3D | 372 | 411 | ||||
ahya_s0011.g37.t1 | SMART | 408 | 441 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 408 | 441 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | Pfam | 411 | 469 | ||||
ahya_s0011.g37.t1 | Gene3D | 412 | 444 | ||||
ahya_s0011.g37.t1 | Gene3D | 445 | 535 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
ahya_s0011.g37.t1 | ProSiteProfiles | 448 | 481 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | SMART | 448 | 481 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
ahya_s0011.g37.t1 | PANTHER | 462 | 538 | ||||
ahya_s0011.g37.t1 | PANTHER | 462 | 538 | ||||
ahya_s0011.g37.t1 | PANTHER | 654 | 928 | ||||
ahya_s0011.g37.t1 | PANTHER | 654 | 928 | ||||
ahya_s0011.g37.t1 | Pfam | 657 | 924 | IPR024983 | CHAT domain | ||
ahya_s0011.g37.t1 | Gene3D | 702 | 925 |
Transcript
Transcript ID | ahya_s0011.g37.t1 |
---|---|
Definition | - |
>ahya_s0011.g37.t1 tttcaaaagtaacaacaggttcttttaagctttcttcgttgtcctcttcgcgtataatagggagcttaagcaaccacgac gacgacggccacatgcaagaaggtcacaaatttgcatatttgacaaagaaaaacaatagttttgcacgctttgtacgtgc atttttcgtttttctacatttcgcagacgttctcgttctttccacgacgtgaaatgacatgttttgcagttgtgtagacg actgtgtcaaaaggataatggctgaacaggccgggaaaggaaaagacttcgacagtcaaagattagatttccagttactg ggtggattacaaacacttcctgagtctcttaaagaacatgtgattattagcattcagaaaggtgatcgggcggatgaggg aaactcctatggaggtctcggtattgctgacttttcactgggtgatttccgaaaagccattgagtatcatgaaaaccact tgaaaattgcaaaagaaatcggtgatcgagtcggaaaagggcgagcctatgaaagtctcggtaatgctcactttgcactg ggtgacatccgaaaagcctttaagtattatgaaaaagacttgaaaattgcaaaagaaatcggtgatcgggccggagaagg acgagcctatggaattctcggcaatgttaacctttcactgggtgacttccgaaaagccattgagtatcatgaaaaacact tgaaaattgcgatagaaataggtgatcgggccggagaaggaggagcctatagaaatctcggtgatgcctactttacactg gttgacttccaaaaagccattgagtaccatgaaaaacacttgaaaattgcaatagaaatcggtgatcgggcgggagaagg aggagcctatggaaatctcggtaatgcttatgcctcactgggtgacatccgaaaagccatagagtatcatgaaaaagact tcaaaattgcaatagaaatcggtgatcgggccggagaaggacgagcctatggaaatctcggtaatgcttacttttcactg ggtgacttccgaaaagccattgagtatgatgaaaaacgcttgaaaattgcaatagaaatcggtgatcgggccggagaagg aagggcctatggaaatctcggtaatgcatacttttcactgggtgacttccgaaaagccattcagtatcatgaaaaacact tgaaaattgcaatagaaatcggttatcgggccagagaaggaggagcttatggcaatctcggtaatgcttatcgttcactg ggtgacatccgaaaagccattgagtatcatgaaaagcacttgaaaattgcaatggaaatcggtgatcgggccggagaagg acgagcctatggaaatcttggtaatgcttatgactcactgggtgacatccgaaaagctattgagtatcatgaaaaacagt tgaaaattgcaatagaaatcggtgatcgagccggagaaggacgatgctatggaaatgttggtaatgcttacttttcactg ggtgacatccgaaaagccctggagtatcacgaaaaacgcttgaaaattgcaatagaaatcggtgatcgggagggagaagc aattgcttatcacaatattggtaagggatactgtggacttggacagtttgacattgcagtggataatgttgtgtccgctg tgggtgtgtttaatactttgagatctctattgaagtttgaaagtaacttgaaaatgaaatttcgtgatctgcgtgagatg acgtacactatgttatggagattattgctaggaattggaaagatcaacgaggctttggttgctgctgatcaaggacgagc gcagactttgtacgacaatttgttgattcaatatggactcgcgtcacccccatcttgtgccacatttgactccacggaga ccacaattcgcctcttcacagagctttctccacaaattatctttctgggactcgcagaactcagcatcaacatttggttt ttgagcaggggacagaacgttgcatttcgacaagggatgctagatgctgatatcacagagaaagatcccatacgcgcctt actacaagcagctttaacaaaaatcgaagctgaagttgaagtaagatgcgaagatcgcacatttgatgagttagacaacg aatgtccgtcaagcagagaagtatgcgaagaggtggaaaagtcatgtcactcttcagacaatccttttaggccaatttat gatgcagtgattgctccaattgttgacttgcttggatctcaattcgacgagttggtcattgtttctgacggtgcgctgtg ctttacaccatgggccgcaattgttgaatcgattaggattcgcactgtcccctctcttaccagttatcagttgatctcaa gtgtacccgagggccatcacaagaagacaggggcgcttttagtcggaaatccgtgcttgaaggagttggagaaacctcta cccgacttaccatgtgctcaagaggaagtagaaatgattgcatcaattctgaacaccagacccctaacagggagagaggc aacaaaagctgaagtgataaaacggatgtcgtcagttgggttaattcacattgctgcccacggaaacaagcgcactggag aaattgccctatctccaaaccctggatggacttccaagttccctcgagaaaaggatttcattttgaaaatgtccgatgta caagcggccaatcttcgagctcgccttgttgtcttaagttgctgtcacagtggacgaggtagaatcttgaagggtgaggg tgtggtcggtatcgcacgtgccttcttggcagctggtgctcgttctgtgttgatatccctgtgggcaatagacgatgaag ctaccatggtgttcatggaaagcttctaccaacagctgaaggaaggaaaaaccgccagtgctgctattcaccaaacgatg aaatcctttcgtgaatctgagaatttttctgagatgaggtactgggctccattccaacttatcggagatgacgtcaagat tgaattcgaggcggatgatgacgtcaaaagttagagaaataataatactgataatagtaa |
Protein
Protein ID | ahya_s0011.g37.t1 |
---|---|
Definition | - |
>ahya_s0011.g37.t1 MAEQAGKGKDFDSQRLDFQLLGGLQTLPESLKEHVIISIQKGDRADEGNSYGGLGIADFSLGDFRKAIEYHENHLKIAKE IGDRVGKGRAYESLGNAHFALGDIRKAFKYYEKDLKIAKEIGDRAGEGRAYGILGNVNLSLGDFRKAIEYHEKHLKIAIE IGDRAGEGGAYRNLGDAYFTLVDFQKAIEYHEKHLKIAIEIGDRAGEGGAYGNLGNAYASLGDIRKAIEYHEKDFKIAIE IGDRAGEGRAYGNLGNAYFSLGDFRKAIEYDEKRLKIAIEIGDRAGEGRAYGNLGNAYFSLGDFRKAIQYHEKHLKIAIE IGYRAREGGAYGNLGNAYRSLGDIRKAIEYHEKHLKIAMEIGDRAGEGRAYGNLGNAYDSLGDIRKAIEYHEKQLKIAIE IGDRAGEGRCYGNVGNAYFSLGDIRKALEYHEKRLKIAIEIGDREGEAIAYHNIGKGYCGLGQFDIAVDNVVSAVGVFNT LRSLLKFESNLKMKFRDLREMTYTMLWRLLLGIGKINEALVAADQGRAQTLYDNLLIQYGLASPPSCATFDSTETTIRLF TELSPQIIFLGLAELSINIWFLSRGQNVAFRQGMLDADITEKDPIRALLQAALTKIEAEVEVRCEDRTFDELDNECPSSR EVCEEVEKSCHSSDNPFRPIYDAVIAPIVDLLGSQFDELVIVSDGALCFTPWAAIVESIRIRTVPSLTSYQLISSVPEGH HKKTGALLVGNPCLKELEKPLPDLPCAQEEVEMIASILNTRPLTGREATKAEVIKRMSSVGLIHIAAHGNKRTGEIALSP NPGWTSKFPREKDFILKMSDVQAANLRARLVVLSCCHSGRGRILKGEGVVGIARAFLAAGARSVLISLWAIDDEATMVFM ESFYQQLKEGKTASAAIHQTMKSFRESENFSEMRYWAPFQLIGDDVKIEFEADDDVKS |