Gene
| Gene Model ID | ahya_s0011.g39 |
|---|---|
| Locus | sc0000011 : 811477 ... 819590 : - |
| To GenomeBrowser | sc0000011:811477..819590 |
| Genes list of scaffold | sc0000011 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| ahya_s0011.g39.t1 | 1 | 1 | TPR_10 | 60 | 89 | 7.9e-34 | 114.5 | 5.3e-06 | 0.0036 | 17.0 |
| ahya_s0011.g39.t1 | 7 | 1 | TPR_12 | 60 | 128 | 0.0 | 278.1 | 1.1e-17 | 7.8e-15 | 54.8 |
| ahya_s0011.g39.t1 | 9 | 1 | TPR_7 | 60 | 93 | 0.0 | 238.3 | 1.7e-09 | 1.1e-06 | 28.0 |
| ahya_s0011.g39.t1 | 9 | 1 | TPR_1 | 60 | 83 | 0.0 | 207.4 | 2.0e-08 | 1.3e-05 | 24.6 |
| ahya_s0011.g39.t1 | 4 | 1 | TPR_8 | 99 | 127 | 2.1e-39 | 130.3 | 7.9e-06 | 0.0054 | 16.7 |
| ahya_s0011.g39.t1 | 9 | 2 | TPR_1 | 99 | 127 | 0.0 | 207.4 | 4.8e-09 | 3.3e-06 | 26.6 |
| ahya_s0011.g39.t1 | 7 | 2 | TPR_12 | 100 | 168 | 0.0 | 278.1 | 4.9e-18 | 3.3e-15 | 56.0 |
| ahya_s0011.g39.t1 | 9 | 2 | TPR_7 | 100 | 134 | 0.0 | 238.3 | 4.3e-09 | 2.9e-06 | 26.8 |
| ahya_s0011.g39.t1 | 4 | 2 | TPR_8 | 139 | 167 | 2.1e-39 | 130.3 | 8.0e-07 | 0.00055 | 19.8 |
| ahya_s0011.g39.t1 | 7 | 3 | TPR_12 | 139 | 208 | 0.0 | 278.1 | 6.7e-16 | 4.6e-13 | 49.1 |
| ahya_s0011.g39.t1 | 9 | 3 | TPR_1 | 139 | 167 | 0.0 | 207.4 | 1.6e-10 | 1.1e-07 | 31.3 |
| ahya_s0011.g39.t1 | 9 | 3 | TPR_7 | 140 | 173 | 0.0 | 238.3 | 1.9e-09 | 1.3e-06 | 27.9 |
| ahya_s0011.g39.t1 | 7 | 4 | TPR_12 | 179 | 243 | 0.0 | 278.1 | 9.7e-15 | 6.6e-12 | 45.4 |
| ahya_s0011.g39.t1 | 9 | 4 | TPR_1 | 179 | 203 | 0.0 | 207.4 | 1.6e-07 | 0.00011 | 21.7 |
| ahya_s0011.g39.t1 | 9 | 4 | TPR_7 | 180 | 213 | 0.0 | 238.3 | 9.8e-07 | 0.00067 | 19.4 |
| ahya_s0011.g39.t1 | 4 | 3 | TPR_8 | 220 | 243 | 2.1e-39 | 130.3 | 2.6e-06 | 0.0018 | 18.2 |
| ahya_s0011.g39.t1 | 7 | 5 | TPR_12 | 220 | 288 | 0.0 | 278.1 | 1.7e-16 | 1.1e-13 | 51.1 |
| ahya_s0011.g39.t1 | 9 | 5 | TPR_7 | 220 | 253 | 0.0 | 238.3 | 3.6e-10 | 2.4e-07 | 30.2 |
| ahya_s0011.g39.t1 | 9 | 5 | TPR_1 | 220 | 243 | 0.0 | 207.4 | 2.7e-08 | 1.8e-05 | 24.2 |
| ahya_s0011.g39.t1 | 9 | 6 | TPR_1 | 259 | 287 | 0.0 | 207.4 | 1.3e-08 | 9.1e-06 | 25.1 |
| ahya_s0011.g39.t1 | 9 | 6 | TPR_7 | 260 | 294 | 0.0 | 238.3 | 4.4e-08 | 3.0e-05 | 23.6 |
| ahya_s0011.g39.t1 | 7 | 6 | TPR_12 | 300 | 368 | 0.0 | 278.1 | 1.3e-16 | 9.0e-14 | 51.4 |
| ahya_s0011.g39.t1 | 9 | 7 | TPR_7 | 300 | 333 | 0.0 | 238.3 | 1.4e-08 | 9.3e-06 | 25.2 |
| ahya_s0011.g39.t1 | 9 | 7 | TPR_1 | 300 | 327 | 0.0 | 207.4 | 6.0e-07 | 0.00041 | 19.9 |
| ahya_s0011.g39.t1 | 4 | 4 | TPR_8 | 339 | 367 | 2.1e-39 | 130.3 | 7.9e-06 | 0.0054 | 16.7 |
| ahya_s0011.g39.t1 | 9 | 8 | TPR_1 | 339 | 367 | 0.0 | 207.4 | 4.8e-09 | 3.3e-06 | 26.6 |
| ahya_s0011.g39.t1 | 9 | 8 | TPR_7 | 340 | 374 | 0.0 | 238.3 | 4.3e-09 | 2.9e-06 | 26.8 |
| ahya_s0011.g39.t1 | 7 | 7 | TPR_12 | 381 | 439 | 0.0 | 278.1 | 1.5e-12 | 1.0e-09 | 38.4 |
| ahya_s0011.g39.t1 | 9 | 9 | TPR_7 | 381 | 414 | 0.0 | 238.3 | 3.9e-09 | 2.6e-06 | 26.9 |
| ahya_s0011.g39.t1 | 9 | 9 | TPR_1 | 381 | 407 | 0.0 | 207.4 | 1.4e-08 | 9.6e-06 | 25.1 |
| ahya_s0011.g39.t1 | 1 | 1 | CHAT | 627 | 894 | 0.0 | 194.7 | 0.0 | 0.0 | 194.3 |
Results of InterPro Scan
| Gene Model ID | Analysis | Start | End | i_acc | i_desc | GO | Pathway |
|---|---|---|---|---|---|---|---|
| ahya_s0011.g39.t1 | Gene3D | 32 | 100 | ||||
| ahya_s0011.g39.t1 | PANTHER | 50 | 103 | ||||
| ahya_s0011.g39.t1 | PANTHER | 50 | 103 | ||||
| ahya_s0011.g39.t1 | SUPERFAMILY | 54 | 246 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g39.t1 | ProSiteProfiles | 58 | 91 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | ProSiteProfiles | 58 | 451 | IPR013026 | Tetratricopeptide repeat-co... | GO:0005515 | |
| ahya_s0011.g39.t1 | SMART | 58 | 91 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | Pfam | 60 | 90 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | ProSiteProfiles | 98 | 131 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | SMART | 98 | 131 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | Pfam | 100 | 168 | ||||
| ahya_s0011.g39.t1 | Gene3D | 101 | 141 | ||||
| ahya_s0011.g39.t1 | PANTHER | 102 | 184 | ||||
| ahya_s0011.g39.t1 | PANTHER | 102 | 184 | ||||
| ahya_s0011.g39.t1 | SMART | 138 | 171 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | ProSiteProfiles | 138 | 171 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | Gene3D | 142 | 187 | ||||
| ahya_s0011.g39.t1 | ProSiteProfiles | 178 | 211 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | SMART | 178 | 211 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | Pfam | 180 | 210 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | PANTHER | 182 | 263 | ||||
| ahya_s0011.g39.t1 | PANTHER | 182 | 263 | ||||
| ahya_s0011.g39.t1 | Gene3D | 188 | 226 | ||||
| ahya_s0011.g39.t1 | SMART | 218 | 251 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | ProSiteProfiles | 218 | 251 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | Pfam | 220 | 288 | ||||
| ahya_s0011.g39.t1 | Gene3D | 227 | 260 | ||||
| ahya_s0011.g39.t1 | SUPERFAMILY | 246 | 456 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g39.t1 | PANTHER | 252 | 439 | ||||
| ahya_s0011.g39.t1 | PANTHER | 252 | 439 | ||||
| ahya_s0011.g39.t1 | ProSiteProfiles | 258 | 291 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | SMART | 258 | 291 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | Gene3D | 261 | 300 | ||||
| ahya_s0011.g39.t1 | SMART | 298 | 331 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | ProSiteProfiles | 298 | 331 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | Pfam | 300 | 368 | ||||
| ahya_s0011.g39.t1 | Gene3D | 301 | 340 | ||||
| ahya_s0011.g39.t1 | ProSiteProfiles | 338 | 371 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | SMART | 338 | 371 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | Gene3D | 341 | 380 | ||||
| ahya_s0011.g39.t1 | ProSiteProfiles | 378 | 411 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | SMART | 378 | 411 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | Gene3D | 381 | 414 | ||||
| ahya_s0011.g39.t1 | Pfam | 381 | 439 | ||||
| ahya_s0011.g39.t1 | Gene3D | 415 | 513 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g39.t1 | ProSiteProfiles | 418 | 451 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | SMART | 418 | 451 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g39.t1 | PANTHER | 441 | 506 | ||||
| ahya_s0011.g39.t1 | PANTHER | 441 | 506 | ||||
| ahya_s0011.g39.t1 | PANTHER | 624 | 898 | ||||
| ahya_s0011.g39.t1 | PANTHER | 624 | 898 | ||||
| ahya_s0011.g39.t1 | Pfam | 627 | 894 | IPR024983 | CHAT domain | ||
| ahya_s0011.g39.t1 | Gene3D | 674 | 895 |
Transcript
| Transcript ID | ahya_s0011.g39.t1 |
|---|---|
| Definition | - |
>ahya_s0011.g39.t1 gacgacattcactgataaccgaaagttggctttcgcccgactaaaaactgaaagatcgccacggccagccaaaatttctt ctatgggaattcgaggacttacccactttgtacattcgactaaaaatctgtggacagcaatcgatcttcaagacacaaaa ctcgtcatagatggactggctctaaattgctgtctcttcgagaacagcgacctcgattatcgatgcggagaaatccgaga tcgggccggagaaggaggagcctatgggaatctcggtattgcttacttttcactgggtgacttccgaaaagccattgagt atcatgaaaaagacttgaaaattgcaatagaaatcggtgatcgagacggagaaggacgagcctatggaaatctcggtatt gcttacagatcactgggtgacatccgaaaagccattgagtatcatgaaaaacacttgaaaattgcaatagaaatcggtga tcgggccggagaaggacgagcctatggaaatctcggtaattgttacttttcactgggtgacatccgaaaagccattgagt atcacgaaaaacacttgaaaattgcaatagaaatcggtgatcgggtgggagaaggacgagcctatggaaatctctgtaat gcttacttttcactgggtgacatccgaaaagccattgagtatcatgaaaaacgcttgaaaattgcaatagaaatcggtga tcgggccggagaaggaggagcatatggaaatctaggtaatgcttatgactcactgggtgacttccgaaaagccattgagt atcacgaaaaagacttgaaaattgcaatagaaatcggtgatcgagacggagaaggacgagcctatggaaatctcggtatt gcttatgactcactgggtgacatccgaaaagccattgagtatcataaaaaacacttgaaaatcgcaatagaaatcggtga tcgggccggagaaggaggagcttatggaaatctcggtaatgcttatgactcactgggtaacttccgattagccattgagt atcgtgaaaaacacttgaaaattgcaatagaaatcggtgatcgagacggagaaggacgagcctatggaaatcttggtatt gcttacagatcactgggtgacatccgaaaagccattgagtatcatgaaaaacacttgaaaattgcaatagaaatcggtga tcgggccggagaaggacgaccgtatggaaatctcggtaatgcttatgcctcactgggtgacatccgaaaagccattgagt atcacgaaaaacacttgaaaattgcaatagaaatcggtgatcgggagggagaaggaatggcttataacaatattggtaat gcatactgtggacttggacagtttgacattgcagtggataatgttgtgtccgctgtgggtgtgtttaatactttgagatc tctattgaagtctgaaagtaacttgaaaatgaaatttcgtgatctgcgtgagattacgtacactacgttatggagattat tgctaagaattggaaggatcaacgaggctttggttgctgctgatcaaggacgagcgcagactttgtacgacaatttgttg attcaatatggactcgcttcacccccatcttgtgccacatttgactccaaggagaccacaattcgcctcttcacagagct ttctccacaaattatctttctgggactcgcagaactcagcatcagcatttggtttttgagaaggggacagaaagttgcat ttcgacaagggatgctagatgctgatatcacagagaaagatcccatacgcgccttactacaagcagctttaacaaaaatc aaagctgagattgaagtgagatgcgaagatcgcacatttgatgagttagacaacgaatgtccgtctaacagagaagtgtg cgaagaggtggaaaagtcatgtcactcttcagacaatccttttaggccaatttatgatgcagtgattgctccaattgttg acttgcttggatctcaattcgacgagttggtcattgtttctgacggtgcgctgtgctttacaccatgggccgcaattgtc gaatcgattagaattcgcactgttccctctcttaccagttatcaattgatctcaagtgtacccgagggccatcacaagaa gagaggggcgcttttagtcggaaatccgtgcttgaaggagttggagaaacctctacccgacttaccatgtgctcaaaagg aagtagaaatgattgcatcaattctgaacaccagacccctaacagggagagaggcaacaaaagctgaagtgttaaaacag atgtcgtcagttggtttaattcacattgctgcccacggaaacaagcgcactggagaaattgccctatctccaaaccttgg atggacttccaagttccctcgagaaaaggattttattttgaaaatgtccgatgtacaagcggccaatcttcgagctcgcc ttgttgtcttaagttgctgtcacagtggacgaggcagaatcttgaagggtgagggtgtggtcggtatcgcacgtgccttc ttggcagctggtgctcgttctgtgttgatatccctgtgggcaatagacgacgaggctaccatggtgttcatgaaaagctt ctaccaacatctgaaggaaggaaaaaccgccagtgctgccattcaccaaacgatgaaatccttccgtgaatctgagaatt tttctgagatgaggtactgggctccattccaacttatcggagatgacgtcaagattgaattcgaggcggatgatgacgtc aaaagttagagaaatatcagtttcttgtgtgtgtttgtgaacataataaccagcgtaataggtt |
|
Protein
| Protein ID | ahya_s0011.g39.t1 |
|---|---|
| Definition | - |
>ahya_s0011.g39.t1 MGIRGLTHFVHSTKNLWTAIDLQDTKLVIDGLALNCCLFENSDLDYRCGEIRDRAGEGGAYGNLGIAYFSLGDFRKAIEY HEKDLKIAIEIGDRDGEGRAYGNLGIAYRSLGDIRKAIEYHEKHLKIAIEIGDRAGEGRAYGNLGNCYFSLGDIRKAIEY HEKHLKIAIEIGDRVGEGRAYGNLCNAYFSLGDIRKAIEYHEKRLKIAIEIGDRAGEGGAYGNLGNAYDSLGDFRKAIEY HEKDLKIAIEIGDRDGEGRAYGNLGIAYDSLGDIRKAIEYHKKHLKIAIEIGDRAGEGGAYGNLGNAYDSLGNFRLAIEY REKHLKIAIEIGDRDGEGRAYGNLGIAYRSLGDIRKAIEYHEKHLKIAIEIGDRAGEGRPYGNLGNAYASLGDIRKAIEY HEKHLKIAIEIGDREGEGMAYNNIGNAYCGLGQFDIAVDNVVSAVGVFNTLRSLLKSESNLKMKFRDLREITYTTLWRLL LRIGRINEALVAADQGRAQTLYDNLLIQYGLASPPSCATFDSKETTIRLFTELSPQIIFLGLAELSISIWFLRRGQKVAF RQGMLDADITEKDPIRALLQAALTKIKAEIEVRCEDRTFDELDNECPSNREVCEEVEKSCHSSDNPFRPIYDAVIAPIVD LLGSQFDELVIVSDGALCFTPWAAIVESIRIRTVPSLTSYQLISSVPEGHHKKRGALLVGNPCLKELEKPLPDLPCAQKE VEMIASILNTRPLTGREATKAEVLKQMSSVGLIHIAAHGNKRTGEIALSPNLGWTSKFPREKDFILKMSDVQAANLRARL VVLSCCHSGRGRILKGEGVVGIARAFLAAGARSVLISLWAIDDEATMVFMKSFYQHLKEGKTASAAIHQTMKSFRESENF SEMRYWAPFQLIGDDVKIEFEADDDVKS |
|