Gene
| Gene Model ID | ahya_s0011.g41 |
|---|---|
| Locus | sc0000011 : 901424 ... 904209 : - |
| To GenomeBrowser | sc0000011:901424..904209 |
| Genes list of scaffold | sc0000011 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| ahya_s0011.g41.t1 | 9 | 1 | TPR_7 | 10 | 44 | 0.0 | 235.7 | 3.0e-10 | 2.0e-07 | 30.4 |
| ahya_s0011.g41.t1 | 6 | 1 | TPR_12 | 10 | 77 | 0.0 | 230.1 | 3.0e-15 | 2.0e-12 | 47.1 |
| ahya_s0011.g41.t1 | 7 | 1 | TPR_1 | 10 | 37 | 0.0 | 193.7 | 1.1e-09 | 7.3e-07 | 28.6 |
| ahya_s0011.g41.t1 | 4 | 1 | TPR_8 | 10 | 38 | 2.4e-41 | 136.4 | 9.8e-08 | 6.4e-05 | 22.7 |
| ahya_s0011.g41.t1 | 6 | 2 | TPR_12 | 49 | 113 | 0.0 | 230.1 | 9.1e-13 | 6.0e-10 | 39.2 |
| ahya_s0011.g41.t1 | 7 | 2 | TPR_1 | 49 | 77 | 0.0 | 193.7 | 9.9e-08 | 6.5e-05 | 22.5 |
| ahya_s0011.g41.t1 | 9 | 2 | TPR_7 | 50 | 83 | 0.0 | 235.7 | 1.6e-06 | 0.0011 | 18.8 |
| ahya_s0011.g41.t1 | 1 | 1 | TPR_10 | 50 | 78 | 7.6e-38 | 127.2 | 4.5e-06 | 0.0029 | 17.3 |
| ahya_s0011.g41.t1 | 9 | 3 | TPR_7 | 90 | 123 | 0.0 | 235.7 | 2.1e-06 | 0.0014 | 18.4 |
| ahya_s0011.g41.t1 | 9 | 4 | TPR_7 | 130 | 163 | 0.0 | 235.7 | 1.3e-08 | 8.5e-06 | 25.3 |
| ahya_s0011.g41.t1 | 7 | 3 | TPR_1 | 130 | 153 | 0.0 | 193.7 | 1.2e-07 | 7.8e-05 | 22.2 |
| ahya_s0011.g41.t1 | 6 | 3 | TPR_12 | 133 | 196 | 0.0 | 230.1 | 1.7e-13 | 1.1e-10 | 41.5 |
| ahya_s0011.g41.t1 | 9 | 5 | TPR_7 | 210 | 242 | 0.0 | 235.7 | 2.7e-08 | 1.8e-05 | 24.3 |
| ahya_s0011.g41.t1 | 7 | 4 | TPR_1 | 210 | 237 | 0.0 | 193.7 | 2.1e-09 | 1.4e-06 | 27.8 |
| ahya_s0011.g41.t1 | 2 | 1 | TPR_2 | 210 | 235 | 7.1e-31 | 103.7 | 3.6e-06 | 0.0023 | 17.8 |
| ahya_s0011.g41.t1 | 6 | 4 | TPR_12 | 211 | 278 | 0.0 | 230.1 | 7.7e-17 | 5.0e-14 | 52.2 |
| ahya_s0011.g41.t1 | 4 | 2 | TPR_8 | 211 | 237 | 2.4e-41 | 136.4 | 4.5e-07 | 0.00029 | 20.7 |
| ahya_s0011.g41.t1 | 7 | 5 | TPR_1 | 249 | 273 | 0.0 | 193.7 | 1.7e-08 | 1.1e-05 | 24.9 |
| ahya_s0011.g41.t1 | 4 | 3 | TPR_8 | 249 | 277 | 2.4e-41 | 136.4 | 8.0e-07 | 0.00052 | 19.9 |
| ahya_s0011.g41.t1 | 9 | 6 | TPR_7 | 250 | 283 | 0.0 | 235.7 | 1.3e-09 | 8.4e-07 | 28.5 |
| ahya_s0011.g41.t1 | 9 | 7 | TPR_7 | 290 | 324 | 0.0 | 235.7 | 4.8e-06 | 0.0031 | 17.3 |
| ahya_s0011.g41.t1 | 6 | 5 | TPR_12 | 291 | 359 | 0.0 | 230.1 | 5.8e-15 | 3.8e-12 | 46.2 |
| ahya_s0011.g41.t1 | 9 | 8 | TPR_7 | 330 | 364 | 0.0 | 235.7 | 3.3e-11 | 2.2e-08 | 33.4 |
| ahya_s0011.g41.t1 | 7 | 6 | TPR_1 | 330 | 357 | 0.0 | 193.7 | 4.3e-11 | 2.8e-08 | 33.1 |
| ahya_s0011.g41.t1 | 4 | 4 | TPR_8 | 330 | 358 | 2.4e-41 | 136.4 | 2.1e-08 | 1.3e-05 | 24.8 |
| ahya_s0011.g41.t1 | 2 | 2 | TPR_2 | 330 | 356 | 7.1e-31 | 103.7 | 1.1e-07 | 7.4e-05 | 22.4 |
| ahya_s0011.g41.t1 | 6 | 6 | TPR_12 | 369 | 429 | 0.0 | 230.1 | 4.9e-11 | 3.2e-08 | 33.6 |
| ahya_s0011.g41.t1 | 7 | 7 | TPR_1 | 369 | 397 | 0.0 | 193.7 | 2.4e-07 | 0.00015 | 21.3 |
| ahya_s0011.g41.t1 | 9 | 9 | TPR_7 | 370 | 404 | 0.0 | 235.7 | 1.1e-07 | 7.1e-05 | 22.4 |
| ahya_s0011.g41.t1 | 1 | 1 | CHAT | 618 | 885 | 0.0 | 187.3 | 0.0 | 0.0 | 187.0 |
Results of InterPro Scan
| Gene Model ID | Analysis | Start | End | i_acc | i_desc | GO | Pathway |
|---|---|---|---|---|---|---|---|
| ahya_s0011.g41.t1 | PANTHER | 1 | 173 | ||||
| ahya_s0011.g41.t1 | Gene3D | 1 | 50 | ||||
| ahya_s0011.g41.t1 | PANTHER | 1 | 173 | ||||
| ahya_s0011.g41.t1 | SUPERFAMILY | 3 | 193 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g41.t1 | ProSiteProfiles | 8 | 41 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | ProSiteProfiles | 8 | 401 | IPR013026 | Tetratricopeptide repeat-co... | GO:0005515 | |
| ahya_s0011.g41.t1 | SMART | 8 | 41 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Pfam | 10 | 77 | ||||
| ahya_s0011.g41.t1 | SMART | 48 | 81 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | ProSiteProfiles | 48 | 81 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Gene3D | 51 | 91 | ||||
| ahya_s0011.g41.t1 | ProSiteProfiles | 88 | 121 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | SMART | 88 | 121 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Pfam | 90 | 122 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Gene3D | 92 | 137 | ||||
| ahya_s0011.g41.t1 | ProSiteProfiles | 128 | 161 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | SMART | 128 | 161 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Pfam | 133 | 196 | ||||
| ahya_s0011.g41.t1 | Gene3D | 138 | 169 | ||||
| ahya_s0011.g41.t1 | PANTHER | 155 | 233 | ||||
| ahya_s0011.g41.t1 | PANTHER | 155 | 233 | ||||
| ahya_s0011.g41.t1 | SUPERFAMILY | 164 | 324 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g41.t1 | ProSiteProfiles | 168 | 201 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | SMART | 168 | 201 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Gene3D | 170 | 216 | ||||
| ahya_s0011.g41.t1 | ProSiteProfiles | 208 | 241 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | SMART | 208 | 241 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Pfam | 211 | 278 | ||||
| ahya_s0011.g41.t1 | Gene3D | 217 | 248 | ||||
| ahya_s0011.g41.t1 | PANTHER | 233 | 419 | ||||
| ahya_s0011.g41.t1 | PANTHER | 233 | 419 | ||||
| ahya_s0011.g41.t1 | SMART | 248 | 281 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | ProSiteProfiles | 248 | 281 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Gene3D | 249 | 290 | ||||
| ahya_s0011.g41.t1 | ProSiteProfiles | 288 | 321 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | SMART | 288 | 321 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Pfam | 291 | 359 | ||||
| ahya_s0011.g41.t1 | Gene3D | 291 | 330 | ||||
| ahya_s0011.g41.t1 | SUPERFAMILY | 313 | 485 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g41.t1 | SMART | 328 | 361 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | ProSiteProfiles | 328 | 361 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Gene3D | 331 | 371 | ||||
| ahya_s0011.g41.t1 | ProSiteProfiles | 368 | 401 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | SMART | 368 | 401 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | Pfam | 369 | 429 | ||||
| ahya_s0011.g41.t1 | Gene3D | 372 | 404 | ||||
| ahya_s0011.g41.t1 | Gene3D | 405 | 490 | IPR011990 | Tetratricopeptide-like heli... | GO:0005515 | |
| ahya_s0011.g41.t1 | SMART | 408 | 441 | IPR019734 | Tetratricopeptide repeat | GO:0005515 | |
| ahya_s0011.g41.t1 | PANTHER | 421 | 498 | ||||
| ahya_s0011.g41.t1 | PANTHER | 421 | 498 | ||||
| ahya_s0011.g41.t1 | PANTHER | 615 | 889 | ||||
| ahya_s0011.g41.t1 | PANTHER | 615 | 889 | ||||
| ahya_s0011.g41.t1 | Pfam | 618 | 885 | IPR024983 | CHAT domain | ||
| ahya_s0011.g41.t1 | Gene3D | 663 | 886 |
Transcript
| Transcript ID | ahya_s0011.g41.t1 |
|---|---|
| Definition | - |
>ahya_s0011.g41.t1 tcatgaaaaatgcttgaaaattgcaatagaaatgggtgatcgggccggagaaggaggagcctatggaaatctcggtaatg cttgtgactcactgggtgacttccgaaaagccattgagtatcatgaaaaatgcttgaaaattgcaatagaaatcggtgat cgggccggagaaggacaagcctatggaaatctcggtaatgcttacagatcactgggtaacttccgaatagccatggagta tcatgaaaaaaacttgaaaattgcaatagaaatcggtgatcgggctggagaaggaggagcctatggaaatctcgctaatg ttaacctttcacagggtgacatccgaaaagccattgagtatcatgaaaaagacttgaaaattacaatagaaatcggtgat cggggcggagaaggaggagcctgtggaaatctcggtattgcttactttttactgggtgacttccgaaaagccattgagta tcatgaaaaacgcttgaaaattgcaatagaaatcggtgatcgggccggagaaggacaagcctatggaaatctcggtattg ctcacagatcactgggtaacttccgaatagccatgaagtatcataaaaaagacttgaaaattgcaatggaaatcggtgat cgggccggagaaggatttgcctttggaaatctcggtaatgcttacttttcactgggtgacatccgaaaagccattaagta tcttgaaaaacacttgaaaattgcaatagaaagcagtgatcgagacggagaagggcgagcctatggaaacatcggtaatg cttatgactcactgggtgacttccgaaaagccattgagtatcatgaaaaacgcttgaaaattgcaatagaaatcggtgat cgggccggagaaggaggagcctttggaaatctcggtaatgcttatgactcactgggtgacatccaaaaagccatggagaa tcgtgaaaaacacttgaaaattgcaatagaaatcggtgatcgggctggagaaggaggagcctatggaaatctcggtaatg cttacaggttactgggtgacttccgaaaagccattgagtattatgaaaaacacttgaaaattgcaacagaaatcggtgat cgggccggagaaggacgagcctatggcaatttcggtattgcttacttttcactgggtgacttccgaaaagccattaagta tcacgaaaaacacttgaaaattgcaatagaaaccggtgatcgggagggagaaggaatggcttatcacaatattggtaagg gatactgtggacttggacagttagacattgcagtggataatattttgtccgctgtgggtgtgtttaatactttgagatct ctattgaagtctgaaagtaactggaaaatgaaatttcgtgatctgcgtgagatgacgtacactacgttatggagattatt gctaagaattggaaagatcaacgaggctttggttgctgctgatcaaggacgagcgcagactttgtacgacaatttgttga ttcaatatggcctcgcttcacccccatcttgtgccacatttgactccaaggagaccacaattcgcctcttcacagagctt tctccacaaattatctttctgggactcgcagaactcagcatcagcatttggtttttgagcaggggacagagagttgcatt tcgacaagggatgctagatgctgatatcacagagaaagatcccatacgcgccttactacaagcagctttaacaaaaatcg aagctgagattgaagtgagatgcgaagatcgcacatttgatgagttagacaacgaatgtccgccgtctagcagagaagtg tgcgaagaggtggaaaagtcatgtgactcttcagacaatccttttaggccaatttatgatgcagtgattgctccaattgt tgacttgcttggatctcaattcgacgatttggtcattgtttctgacggtgccctgtgctttacaccatgggccgccattg ttgaatcgattaggattcgcactgtcccctctcttaccagttatcaattgatctcaagggtacccgagggctatcacaag aagacaggggcgcttttagtcggaaatccgtgcttgaaggagttggagaaacctctacccgacttaccatgtgctcaaaa ggaagtagaaatgattgcatcaattctgaacaccagacccctaacagggagagaggcaacaaaagctgaagtgataaaac ggatgtcgtcagttggtttaattcacattgctgcccacggaaacaagcgcactggagaaattgccctatgtccaaacctt ggatggacttccaagttccctcgagaaaaggatttcattttgaaaatgtccgatgtacaagcggccaatattcgagctcg ccttgttgtcttaagttgctgtcacagtggacgaggcagaatcttgaagggtgagggtgtggtcggtatcgcacgtgcct tcttggcagctggtgctcgttctgtgttgatatccctgtgggcaatagacgatgaagctacaatggtgttcatgaaaagc ttctaccaacagctgaaggaaggaaaaaccgccagtgctgctattcaccaaacgatgaaatcctttcgtgaatctgagaa tttttctgagatgaggtactgggctccatttcaacttatcggagatgacgtcaggattgaattcgaggcggatgatgacg tcaaaagttagagaaacaacagttccttttgtgtgtttgtgaacataatatatgtgaatttatatg |
|
Protein
| Protein ID | ahya_s0011.g41.t1 |
|---|---|
| Definition | - |
>ahya_s0011.g41.t1 MGDRAGEGGAYGNLGNACDSLGDFRKAIEYHEKCLKIAIEIGDRAGEGQAYGNLGNAYRSLGNFRIAMEYHEKNLKIAIE IGDRAGEGGAYGNLANVNLSQGDIRKAIEYHEKDLKITIEIGDRGGEGGACGNLGIAYFLLGDFRKAIEYHEKRLKIAIE IGDRAGEGQAYGNLGIAHRSLGNFRIAMKYHKKDLKIAMEIGDRAGEGFAFGNLGNAYFSLGDIRKAIKYLEKHLKIAIE SSDRDGEGRAYGNIGNAYDSLGDFRKAIEYHEKRLKIAIEIGDRAGEGGAFGNLGNAYDSLGDIQKAMENREKHLKIAIE IGDRAGEGGAYGNLGNAYRLLGDFRKAIEYYEKHLKIATEIGDRAGEGRAYGNFGIAYFSLGDFRKAIKYHEKHLKIAIE TGDREGEGMAYHNIGKGYCGLGQLDIAVDNILSAVGVFNTLRSLLKSESNWKMKFRDLREMTYTTLWRLLLRIGKINEAL VAADQGRAQTLYDNLLIQYGLASPPSCATFDSKETTIRLFTELSPQIIFLGLAELSISIWFLSRGQRVAFRQGMLDADIT EKDPIRALLQAALTKIEAEIEVRCEDRTFDELDNECPPSSREVCEEVEKSCDSSDNPFRPIYDAVIAPIVDLLGSQFDDL VIVSDGALCFTPWAAIVESIRIRTVPSLTSYQLISRVPEGYHKKTGALLVGNPCLKELEKPLPDLPCAQKEVEMIASILN TRPLTGREATKAEVIKRMSSVGLIHIAAHGNKRTGEIALCPNLGWTSKFPREKDFILKMSDVQAANIRARLVVLSCCHSG RGRILKGEGVVGIARAFLAAGARSVLISLWAIDDEATMVFMKSFYQQLKEGKTASAAIHQTMKSFRESENFSEMRYWAPF QLIGDDVRIEFEADDDVKS |
|