Gene
Gene Model ID | ahya_s0011.g44 |
---|---|
Locus | sc0000011 : 939800 ... 950572 : + |
To GenomeBrowser | sc0000011:939800..950572 |
Genes list of scaffold | sc0000011 |
Hmmer Search for Pfam
query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
---|---|---|---|---|---|---|---|---|---|---|
ahya_s0011.g44.t1 | 4 | 1 | WD40 | 84 | 111 | 3.0e-33 | 113.2 | 2.1e-08 | 3.8e-05 | 24.2 |
ahya_s0011.g44.t1 | 4 | 2 | WD40 | 118 | 154 | 3.0e-33 | 113.2 | 5.0e-06 | 0.0091 | 16.7 |
ahya_s0011.g44.t1 | 4 | 3 | WD40 | 215 | 246 | 3.0e-33 | 113.2 | 6.8e-07 | 0.0012 | 19.5 |
ahya_s0011.g44.t1 | 1 | 1 | ANAPC4_WD40 | 228 | 313 | 9.4e-12 | 44.9 | 1.1e-06 | 0.002 | 18.3 |
ahya_s0011.g44.t1 | 4 | 4 | WD40 | 256 | 290 | 3.0e-33 | 113.2 | 3.0e-07 | 0.00054 | 20.6 |
Results of InterPro Scan
Gene Model ID | Analysis | Start | End | i_acc | i_desc | GO | Pathway |
---|---|---|---|---|---|---|---|
ahya_s0011.g44.t1 | ProSiteProfiles | 1 | 318 | IPR017986 | WD40-repeat-containing domain | GO:0005515 | |
ahya_s0011.g44.t1 | Gene3D | 2 | 48 | ||||
ahya_s0011.g44.t1 | PANTHER | 10 | 315 | IPR037588 | Target of rapamycin complex... | GO:0031929|GO:0031931|GO:00... | Reactome: R-HSA-1257604|Reactome: R-HSA-1632852|Reactome: R-HSA-165159|Reactome: R-HSA-166208|Reactome: R-HSA-3371571|Reactome: R-HSA-380972|Reactome: R-HSA-389357|Reactome: R-HSA-5218920|Reactome: R-HSA-5628897|Reactome: R-HSA-5674400|Reactome: R-HSA-6804757|Reactome: R-HSA-8943724 |
ahya_s0011.g44.t1 | PANTHER | 10 | 315 | ||||
ahya_s0011.g44.t1 | SUPERFAMILY | 12 | 312 | IPR011047 | Quinoprotein alcohol dehydr... | ||
ahya_s0011.g44.t1 | CDD | 12 | 290 | ||||
ahya_s0011.g44.t1 | SMART | 29 | 67 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | Pfam | 35 | 67 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | Gene3D | 49 | 114 | ||||
ahya_s0011.g44.t1 | SMART | 72 | 111 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | ProSiteProfiles | 79 | 120 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | Pfam | 84 | 111 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | PRINTS | 98 | 112 | IPR020472 | G-protein beta WD-40 repeat | ||
ahya_s0011.g44.t1 | ProSitePatterns | 98 | 112 | IPR019775 | WD40 repeat, conserved site | ||
ahya_s0011.g44.t1 | Gene3D | 115 | 213 | IPR011042 | Six-bladed beta-propeller, ... | ||
ahya_s0011.g44.t1 | SMART | 116 | 154 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | Pfam | 118 | 154 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | SMART | 157 | 196 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | SMART | 207 | 247 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | Gene3D | 214 | 256 | ||||
ahya_s0011.g44.t1 | Pfam | 215 | 246 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | ProSiteProfiles | 215 | 256 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | PRINTS | 234 | 248 | IPR020472 | G-protein beta WD-40 repeat | ||
ahya_s0011.g44.t1 | SMART | 250 | 290 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | Pfam | 256 | 290 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | Gene3D | 257 | 287 | ||||
ahya_s0011.g44.t1 | ProSiteProfiles | 258 | 299 | IPR001680 | WD40 repeat | GO:0005515 | |
ahya_s0011.g44.t1 | PRINTS | 277 | 291 | IPR020472 | G-protein beta WD-40 repeat | ||
ahya_s0011.g44.t1 | ProSitePatterns | 277 | 291 | IPR019775 | WD40 repeat, conserved site | ||
ahya_s0011.g44.t1 | Gene3D | 288 | 317 |
Blast Hit to nr / sp
query | Subject ID | Subject Name | evalue |
---|---|---|---|
ahya_s0011.g44.t1 | sp|Q803V5|LST8_DANRE | Target of rapamycin complex subunit lst8 | 0.0 |
ahya_s0011.g44.t1 | sp|Q6PA72|LST8_XENLA | Target of rapamycin complex subunit lst8 | 0.0 |
ahya_s0011.g44.t1 | sp|Q9DCJ1|LST8_MOUSE | Target of rapamycin complex subunit LST8 | 0.0 |
ahya_s0011.g44.t1 | sp|Q17QU5|LST8_BOVIN | Target of rapamycin complex subunit LST8 | 0.0 |
ahya_s0011.g44.t1 | sp|Q5I0B4|LST8_XENTR | Target of rapamycin complex subunit lst8 | 0.0 |
Transcript
Transcript ID | ahya_s0011.g44.t1 |
---|---|
Definition | - |
>ahya_s0011.g44.t1 cttcgaagttttaattatttttatcgctgaaagttagtggcaatgtgctttattataggttttaaataccatgaagtcac agataagctgaagcgggtggaaatttaaaaaaagatgacagaaacagatgggtcaagtgaagcagttattctggccacag cgggctatgatcacgctatcaaattttggcaagctcacagtggaatatgccataggacagttcaacatccagactctcaa gtgaatgccatgcagattactcctgacagacagttattagctgcagcaggttaccaacacattcgcatgtatgatatcaa ctcaagcaacccaaatcctgttgtaaattatgatggtgtatccaaaaatgtgacagcagttggatttcatgaagatggca aatggatgtacactggtggagaagattgttcagccagaatatgggacttgagatcacgcaatcttcagtgccagagagtg tttcaagtgaatgctccagtgaactgtgtttgtcttcatcctaaccagggtgagcttattgttggtgatcaaagtggtgc aattcacatgtgggatctcaagacagatcacaacgaacagcttattcctgagtcagaagcatctattttgtccatcagta ttgatagagaagcatcatacatggcgtctgtaaacaatcagggtaactgctatgtatggagcctcacaggaggaaccaga gacgagccaactgtcctgcaccccagaacaaaaatccctcatgcacataaacgagcagccttaaagtgcctgtttagtcc agattcttgctttttagccacaacatctgccgacaccacagtcaacatttggcaaacatctgacttctctctcaaaaaga ctcttaaagaagctaatcaaagatgggtgtgggattgtgccttctctgaagactctcagtatctgatcacagcatcgtcg gacaatatggctcgcttatggaatttggatcacggagaagtggtccgtgagtacagcggacatcaaaaagctgtggtatc actggctttcagagatgcgcatgctgtatagtgaacaaaattgccatggttactttacaagagctaacacagcattgagt tttcatatcaactcgttacttttgtaacataaagagttttaacaaaagttctgaaacaaaacatttgtaaatgaaggaaa gtctatccaatacgacgtcattgactaatgaactaagtcgctcttcatgatttttatattgacttactagtaaataatta tgataactttttggttacttttggatcagggaagggctatatgcatggcgttttacgctgtatgatatctctcacttatt acgcgcactctaatcggtcaattttgcggtccatattctactgcatgtaaggcccgctacgtcctgcaaaatttaaaatg ttggcgagtttcctttcttgcgctcctgattaacctcatagataaaagaaatatcttaccatcctcgtttttcggtcaga actgtaagttacgaatcgtcgtttttttcccgttgatttataaacagaaaaaactcggttagtaagaggtatttacgtga cggcatttactgttcttaagtgtattgagttgtaaacagtgctccgatggagagcaaaataagtctggaattatttttga ctcttgtagttttttttttttttttgtaagacttccgacagcactttgaaagaataaagtgccttcaacact |
Protein
Protein ID | ahya_s0011.g44.t1 |
---|---|
Definition | - |
>ahya_s0011.g44.t1 MTETDGSSEAVILATAGYDHAIKFWQAHSGICHRTVQHPDSQVNAMQITPDRQLLAAAGYQHIRMYDINSSNPNPVVNYD GVSKNVTAVGFHEDGKWMYTGGEDCSARIWDLRSRNLQCQRVFQVNAPVNCVCLHPNQGELIVGDQSGAIHMWDLKTDHN EQLIPESEASILSISIDREASYMASVNNQGNCYVWSLTGGTRDEPTVLHPRTKIPHAHKRAALKCLFSPDSCFLATTSAD TTVNIWQTSDFSLKKTLKEANQRWVWDCAFSEDSQYLITASSDNMARLWNLDHGEVVREYSGHQKAVVSLAFRDAHAV |