Gene
| Gene Model ID | habu1_s105_g00544 |
|---|---|
| Locus | habu1_scaffold105 : 170699 ... 174845 : - |
| To GenomeBrowser | habu1_scaffold105:170699..174845 |
| Genes list of scaffold | habu1_scaffold105 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| aminoacyl trna synthase complex-interacting multifunctional protein 2 isoform x1 | GO:0005634 GO:0008285 GO:0016020 GO:0031398 GO:0060510 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s105_g00544.t1 | 1 | 1 | GST_C_3 | 235 | 314 | 1.3e-06 | 28.7 | 6.4e-10 | 3.2e-06 | 27.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s105_g00544.t1 | gi|637355239|ref|XP_008119091.1| | PREDICTED: aminoacyl tRNA synthase complex-interacting multifunctional protein 2 isoform X1 [Anolis carolinensis] | 0.0 |
| habu1_s105_g00544.t1 | gi|543358013|ref|XP_005523021.1| | PREDICTED: aminoacyl tRNA synthase complex-interacting multifunctional protein 2 isoform X1 [Pseudopodoces humilis] | 0.0 |
| habu1_s105_g00544.t1 | gi|334332779|ref|XP_003341646.1| | PREDICTED: aminoacyl tRNA synthase complex-interacting multifunctional protein 2 isoform X3 [Monodelphis domestica] | 0.0 |
| habu1_s105_g00544.t1 | gi|683917197|ref|XP_009090104.1| | PREDICTED: aminoacyl tRNA synthase complex-interacting multifunctional protein 2 isoform X1 [Serinus canaria] | 0.0 |
| habu1_s105_g00544.t1 | gi|530635800|ref|XP_005304758.1| | PREDICTED: aminoacyl tRNA synthase complex-interacting multifunctional protein 2 isoform X1 [Chrysemys picta bellii] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 10.0 |
| Venom grand-1 | 22.6 |
| Pit, infrared sensing | 12.9 |
| Nose | 16.9 |
| Brain-1 | 7.9 |
| Eye | 17.0 |
| fetal fibroblast | 41.3 |
| venom gland-2 | 55.2 |
| Brain-2 | 8.0 |
| Spleen | 13.1 |
| Lung | 6.8 |
| Liver | 10.0 |
| Kidney | 13.1 |
| Pancreas | 37.9 |
| Small intestine | 20.1 |
| Large intestine | 8.9 |
| Stomach | 19.7 |
| heart | 22.2 |
| ovary | 60.1 |
| cheek muscle | 32.8 |
Transcript
| Transcript ID | habu1_s105_g00544.t1 |
|---|---|
| Definition | - |
>habu1_s105_g00544.t1 ggccgacgggagccgccaatcgcctccgcggccgtggccaggcggccaatgggaggcgtgacgggcggggcggcaggcgg ggctcctccaatgggaggcgggggcggcgccggcacgtcagtcggccgtggcgtgaggagaagcggcgggtcggccgcga tgccgatgtacaaggtgaggccctttcaggacggcgccggcccggcggtcctggcccagcacctccccacctgcatgtac cgcatgcgctgcgcccaccgcgaggccgacaggccccccggccttgcctcctcgccgccgccgccgccgcctcagcagga tgaagttgatccaacactccaggctcttgaattccgccaggaagagatcttgaaacgtttgtatgaattgaaagctgctg tggatggcctctcaaaaatgatccagacaccagatgcagacttcgatgccactaacataattcaaacagatgaccatgtt tctctaactgtcagctctgcagaacttgatagtctgcttgggaaggattacggtggcctgaaggatattgtcatcaatgc gagcccctctttccctccactgtcgttgttaattctccacagttttctgtgtgagaagtacaagatcctttcaacggttc acacacactcatccgtgaaaaacgtgccagaaaagctcctcaaatgctttggtgagcaggcaaagaaacaatcgcgccac gaataccagctgggcgttactttaatttggaaagatgtgccaaaaccccagatgaagttcagcgtccaaaccatgtgccc cattgaaggcgaagggaacattgctaggttcttattctccttgctcggtgcaaagcataacgcggtcacagcgactctga tagacagctgggtcgacaccgccctcttccaactccaagggggaagcaataaggaaaaagcagccgttctgcggggcatg aacgcaaccctgggcaagacctcctggctggtgggcaacgagttgacggtcgcagatgtggtggcctggtgtgcccttca gcagacggggggcaccgaggacgtcccggcccatgtgcagaaatggctgcggtcttgtgagaatctggcaccgtttaacg ctgctctcaagctactgaagtgactttctctcctgcgggcaggcaagcaccttcaactctttcgacatctctggcaatga atcttgagaggatggttggataaatcagatttgagaaataaccaaagctgtaatgccaataaaagttcatcagagttgtc ctttg |
|
Protein
| Protein ID | habu1_s105_g00544.t1 |
|---|---|
| Definition | - |
>habu1_s105_g00544.t1 MPMYKVRPFQDGAGPAVLAQHLPTCMYRMRCAHREADRPPGLASSPPPPPPQQDEVDPTLQALEFRQEEILKRLYELKAA VDGLSKMIQTPDADFDATNIIQTDDHVSLTVSSAELDSLLGKDYGGLKDIVINASPSFPPLSLLILHSFLCEKYKILSTV HTHSSVKNVPEKLLKCFGEQAKKQSRHEYQLGVTLIWKDVPKPQMKFSVQTMCPIEGEGNIARFLFSLLGAKHNAVTATL IDSWVDTALFQLQGGSNKEKAAVLRGMNATLGKTSWLVGNELTVADVVAWCALQQTGGTEDVPAHVQKWLRSCENLAPFN AALKLLK |
|