Gene
| Gene Model ID | habu1_s1235_g04293 |
|---|---|
| Locus | habu1_scaffold1235 : 268116 ... 275045 : + |
| To GenomeBrowser | habu1_scaffold1235:268116..275045 |
| Genes list of scaffold | habu1_scaffold1235 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s1235_g04293.t1 | 1 | 1 | SOUL | 17 | 174 | 1.4e-29 | 102.8 | 3.7e-32 | 5.6e-28 | 97.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s1235_g04293.t1 | gi|602632765|ref|XP_007423270.1| | PREDICTED: heme-binding protein 1 [Python bivittatus] | 0.0 |
| habu1_s1235_g04293.t1 | gi|637301437|ref|XP_003221095.2| | PREDICTED: heme-binding protein 1 [Anolis carolinensis] | 0.0 |
| habu1_s1235_g04293.t1 | gi|686587769|ref|XP_009288324.1| | PREDICTED: heme-binding protein 1 [Aptenodytes forsteri] | 0.0 |
| habu1_s1235_g04293.t1 | gi|564261658|ref|XP_006269721.1| | PREDICTED: heme-binding protein 1 [Alligator mississippiensis] | 0.0 |
| habu1_s1235_g04293.t1 | gi|530644609|ref|XP_005308978.1| | PREDICTED: heme-binding protein 1 [Chrysemys picta bellii] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 7.1 |
| Venom grand-1 | 4.8 |
| Pit, infrared sensing | 8.6 |
| Nose | 17.3 |
| Brain-1 | 3.6 |
| Eye | 3.8 |
| fetal fibroblast | 27.3 |
| venom gland-2 | 10.5 |
| Brain-2 | 1.5 |
| Spleen | 2.1 |
| Lung | 12.7 |
| Liver | 6.6 |
| Kidney | 3.9 |
| Pancreas | 2.2 |
| Small intestine | 1.1 |
| Large intestine | 6.7 |
| Stomach | 7.2 |
| heart | 11.4 |
| ovary | 19.3 |
| cheek muscle | 1.2 |
Transcript
| Transcript ID | habu1_s1235_g04293.t1 |
|---|---|
| Definition | - |
>habu1_s1235_g04293.t1 ccgggaagtgctgcttcttgcggagcggatcatccgccagagccgttcagcatgtttggaatgatcagaaattccctttt tggcaccgcggaggtttggccctgccgagttctgagccagggggagaaggatgatgtagcctatgaggaaaggacatacg aaggtgggatgtttgccagtgttgaactctctggaaagccctttgacgaggctttacgtgaagcagtgctgaagcttctt aaatatgttggaggaagcaataatcaaggagctggcatggggatgatggctccagtgtgtagcacagtctttcctgcaga ggacggcttattgcagcacaaagtgaaagtcctgctacggattccaagccagttccaggacaaccccccttcaccgagtg atgagagcatccagtttggaggctatgcaaaagaagcagactatgtgaattatgcagccaagctaacctctgctttagga aatgaggcatcgttctgcaaagacttctatttttgcaatggttatgatcctcccatgaaaccttatgggcggcacaatga agtttggctgttgaaaaagtgaccaaataaaaaagctgtcccaatttcttgaa |
|
Protein
| Protein ID | habu1_s1235_g04293.t1 |
|---|---|
| Definition | - |
>habu1_s1235_g04293.t1 MFGMIRNSLFGTAEVWPCRVLSQGEKDDVAYEERTYEGGMFASVELSGKPFDEALREAVLKLLKYVGGSNNQGAGMGMMA PVCSTVFPAEDGLLQHKVKVLLRIPSQFQDNPPSPSDESIQFGGYAKEADYVNYAAKLTSALGNEASFCKDFYFCNGYDP PMKPYGRHNEVWLLKK |
|