Gene
| Gene Model ID | habu1_s1235_g04299 |
|---|---|
| Locus | habu1_scaffold1235 : 380206 ... 380816 : + |
| To GenomeBrowser | habu1_scaffold1235:380206..380816 |
| Genes list of scaffold | habu1_scaffold1235 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| histone partial | GO:0000786 GO:0003677 GO:0005634 GO:0046982 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s1235_g04299.t1 | 1 | 1 | Histone | 58 | 132 | 3.8e-33 | 113.4 | 1.6e-36 | 5.9e-33 | 112.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s1235_g04299.t1 | gi|170053486|ref|XP_001862696.1| | Histone H3c [Culex quinquefasciatus] | 0.0 |
| habu1_s1235_g04299.t1 | gi|170059756|ref|XP_001865500.1| | histone H3.3 type 2 [Culex quinquefasciatus] | 0.0 |
| habu1_s1235_g04299.t1 | gi|543348276|ref|XP_005519548.1| | PREDICTED: histone H3.2-like isoform X1 [Pseudopodoces humilis] | 0.0 |
| habu1_s1235_g04299.t1 | gi|410927800|ref|XP_003977328.1| | 0.0 | |
| habu1_s1235_g04299.t1 | gi|7305139|ref|NP_038576.1| | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 7.2 |
| Venom grand-1 | 157.1 |
| Pit, infrared sensing | 5.6 |
| Nose | 4.3 |
| Brain-1 | 0.9 |
| Eye | 9.4 |
| fetal fibroblast | 3.4 |
| venom gland-2 | 80.0 |
| Brain-2 | 0.9 |
| Spleen | 10.3 |
| Lung | 1.2 |
| Liver | 3.6 |
| Kidney | 2.3 |
| Pancreas | 34.3 |
| Small intestine | 0.7 |
| Large intestine | 2.2 |
| Stomach | 28.9 |
| heart | 2.0 |
| ovary | 13.8 |
| cheek muscle | 19.9 |
Transcript
| Transcript ID | habu1_s1235_g04299.t1 |
|---|---|
| Definition | - |
>habu1_s1235_g04299.t1 taagactttttctcgcccacctttggcgcgaacagggagatggcccggacgaagcagacggctcggaagtcaactggcgg caaagcgccccgcaagcagctggcgaccaaggctgcccgcaagagcgccccggctacgggcggcgtgaagaagcctcacc gctaccgcccgggcaccgtggccctgcgagagatccgccgctaccagaagtccaccgagctgctgatccgcaagctgccc ttccagcggctggtgcgtgaaatcgcccaagacttcaagaccgacctgcgcttccagagctcggccgtgatggcgctgca ggaggcgagcgaagcgtacttggtggggctgttcgaggacacgaatctgtgcgccattcacgccaagagggtgaccatca tgccgaaggacattcagctggcgcggcgcatccgcggggagagagcttaagtccgcgctcctccagtttcggcctctctc ggaaaataacacgatacccaaaggctcttttaagagccgccaccttcgtctcggaaagagccgagtccatatgtcaagca aatcccagcgattaaggcgggttaataaatgccgtttactatcataatgta |
|
Protein
| Protein ID | habu1_s1235_g04299.t1 |
|---|---|
| Definition | - |
>habu1_s1235_g04299.t1 MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
|