Gene
| Gene Model ID | habu1_s1301_g04553 |
|---|---|
| Locus | habu1_scaffold1301 : 99659 ... 159005 : - |
| To GenomeBrowser | habu1_scaffold1301:99659..159005 |
| Genes list of scaffold | habu1_scaffold1301 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| insulin-like growth factor 2 mrna-binding protein 1 isoform x1 | GO:0000166 GO:0003730 GO:0006445 GO:0010494 GO:0010610 GO:0017148 GO:0045182 GO:0048027 GO:0070934 GO:0070937 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s1301_g04553.t1 | 2 | 1 | RRM_1 | 4 | 68 | 1.3e-16 | 59.9 | 5.2e-09 | 7.0e-06 | 25.5 |
| habu1_s1301_g04553.t1 | 2 | 1 | RRM_6 | 4 | 69 | 1.2e-15 | 57.2 | 5.7e-11 | 7.6e-08 | 32.2 |
| habu1_s1301_g04553.t1 | 2 | 2 | RRM_6 | 83 | 150 | 1.2e-15 | 57.2 | 5.5e-08 | 7.5e-05 | 22.6 |
| habu1_s1301_g04553.t1 | 2 | 2 | RRM_1 | 85 | 150 | 1.3e-16 | 59.9 | 5.5e-11 | 7.4e-08 | 31.9 |
| habu1_s1301_g04553.t1 | 1 | 1 | RRM_5 | 100 | 153 | 1.1e-09 | 37.9 | 1.0e-08 | 1.4e-05 | 24.8 |
| habu1_s1301_g04553.t1 | 4 | 1 | KH_1 | 198 | 260 | 0.0 | 179.7 | 1.4e-16 | 1.9e-13 | 49.8 |
| habu1_s1301_g04553.t1 | 2 | 1 | KH_2 | 202 | 232 | 5.6e-19 | 67.4 | 4.3e-07 | 0.00059 | 19.3 |
| habu1_s1301_g04553.t1 | 4 | 1 | KH_3 | 206 | 246 | 1.9e-35 | 119.9 | 1.0e-10 | 1.4e-07 | 31.0 |
| habu1_s1301_g04553.t1 | 4 | 2 | KH_1 | 280 | 343 | 0.0 | 179.7 | 9.2e-16 | 1.2e-12 | 47.2 |
| habu1_s1301_g04553.t1 | 2 | 2 | KH_2 | 280 | 310 | 5.6e-19 | 67.4 | 3.9e-06 | 0.0052 | 16.3 |
| habu1_s1301_g04553.t1 | 4 | 2 | KH_3 | 287 | 331 | 1.9e-35 | 119.9 | 3.3e-10 | 4.5e-07 | 29.3 |
| habu1_s1301_g04553.t1 | 4 | 3 | KH_1 | 407 | 468 | 0.0 | 179.7 | 3.9e-15 | 5.2e-12 | 45.2 |
| habu1_s1301_g04553.t1 | 4 | 3 | KH_3 | 416 | 457 | 1.9e-35 | 119.9 | 2.2e-11 | 2.9e-08 | 33.1 |
| habu1_s1301_g04553.t1 | 4 | 4 | KH_1 | 489 | 552 | 0.0 | 179.7 | 1.2e-14 | 1.6e-11 | 43.6 |
| habu1_s1301_g04553.t1 | 1 | 1 | KH_4 | 489 | 518 | 2.0e-15 | 56.1 | 1.3e-06 | 0.0018 | 17.8 |
| habu1_s1301_g04553.t1 | 4 | 4 | KH_3 | 498 | 535 | 1.9e-35 | 119.9 | 3.4e-11 | 4.6e-08 | 32.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s1301_g04553.t1 | gi|602645076|ref|XP_007428980.1| | PREDICTED: insulin-like growth factor 2 mRNA-binding protein 1 isoform X1 [Python bivittatus] | 0.0 |
| habu1_s1301_g04553.t1 | gi|637315633|ref|XP_008111710.1| | PREDICTED: insulin-like growth factor 2 mRNA-binding protein 1 [Anolis carolinensis] | 0.0 |
| habu1_s1301_g04553.t1 | gi|591374582|ref|XP_007061977.1| | PREDICTED: insulin-like growth factor 2 mRNA-binding protein 1 isoform X1 [Chelonia mydas] | 0.0 |
| habu1_s1301_g04553.t1 | gi|530624828|ref|XP_005301966.1| | PREDICTED: insulin-like growth factor 2 mRNA-binding protein 1 isoform X1 [Chrysemys picta bellii] | 0.0 |
| habu1_s1301_g04553.t1 | gi|564242324|ref|XP_006277965.1| | PREDICTED: insulin-like growth factor 2 mRNA-binding protein 1 isoform X2 [Alligator mississippiensis] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.0 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 0.1 |
| Nose | 0.0 |
| Brain-1 | 0.0 |
| Eye | 0.1 |
| fetal fibroblast | 3.8 |
| venom gland-2 | 0.0 |
| Brain-2 | 0.0 |
| Spleen | 0.0 |
| Lung | 0.1 |
| Liver | 0.0 |
| Kidney | 0.0 |
| Pancreas | 0.0 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.4 |
| cheek muscle | 0.0 |
Transcript
| Transcript ID | habu1_s1301_g04553.t1 |
|---|---|
| Definition | - |
>habu1_s1301_g04553.t1 tgagttattttcttccttccctcccacctcccgtgactcactcccgttttggacctacccagcattttgtgcaaaacgca tcagccatgaacaagctgtatattggaaacctcaacgagaacgtgactccggcggatctggagaaagtcttcaacgacca caaaatatccttctcaggccagttcttggtgaagtctggctacgccttcgtcgactgcccagatgagcaatgggctatga aagccatcgaaactttttctggcaaagtggagttgcatgggaaacaacttgagattgaacactcagtccctaaaaaacaa aggagccgcaaaattcagataagaaatatcccacctcagcttcggtgggaggtcttggatggtttgctggctcaatatgg tactgtggaaaactgtgaacaagtgaatacggatagcgagacagcagttgttaatgtcacctattctaaccgggaacaga ccagacaagctatcatgaaacttaatggacatcaactggaaaaccatgcattgaaggtctcttacatacctgatgaacag actgtgcagggtgcagagaatggacgtcgaggtggttttggaacacggggtgccccacggcaaggttctcctgtggcttc aggagctcctgtgaaacagcaaccagtagatatcccccttcggcttcttgttcctacccagtatgtgggagccattattg gtaaagaaggtgccaccatccgcaacataaccaaacagacacagtccaaaattgatgtgcatcggaaggaaaatgcgggg gcggcagagaaagcaataagcatccattcaactccagaaggctgttctgctgcttgcaagatgatattggaaatcatgca gaaggaggcaaaagacaccaagactgctgatgaagtacctctgaaaatcctagcccacaacaactttgtgggacgactga ttggcaaggagggccgcaacctgaagaaagtagaacaggacacagagacaaagatcaccatctcctcccttcaggatttg acattatacaaccctgaaaggactatcactgtgaaaggctccattgataattgctgcagagcagaacaagaaattatgaa gaaagtgagggaggcttatgagaatgatgtagcagccatgagtctacagtcacacttgatacctggtctcaacctagctg ctgttggtctctttcctgcttcttccaatgcagtgccccctcctccaagtagtgtttctggagcagctccatataattct tttttgcctcctgagcaagagaccgtgcatgttttcatccctgcccaggctgtaggtgcaatcattggcaagaaggggca gcacatcaaacagctctccagattcgcaagtgcctcaatcaagattgctcctccagagacgccagattccaaagtgcgta tggtgataatcactggaccgccagaagcccaatttaaggctcaaggacgaatttatggaaagctgaaagaggagaacttt tttgggcccaaagaagaagtgaaacttgagacgcacatccgagtccctgcctcagcagcaggaagagtcattggcaaagg aggcaaaacagtcaatgaacttcagaacctgacagcagctgaggtagttgttccccgggatcaaacccctgatgagaatg agcaagtcattgtcaaaatcatcggacatttctatgctagccagatggctcaacgcaaaatacgtgatatccttgctcag gtgaaacaacagcatcaaaagggacagaacagccagacacaagcacgaaggaaataggaaatgacttgtacccgggtgta tgaaagaagagagagagagagaaagagtgagagatggacagatggatgaacaacattgacaatggatgaaacaaagccaa gcagaaaagaatgatgatctgtttcagaaccctaagagtggctgggattcagtttaccgtaggcaggtattaataatttt ttggagatgggtgtcttattctatcatgagcatatacgtgtctgtattaatacagatgtggactctcacacaaaggtatt ttcacacagtatactatttggggggggggatactaagttcagcaataaacaagaagttttaaatcaaatta |
|
Protein
| Protein ID | habu1_s1301_g04553.t1 |
|---|---|
| Definition | - |
>habu1_s1301_g04553.t1 MNKLYIGNLNENVTPADLEKVFNDHKISFSGQFLVKSGYAFVDCPDEQWAMKAIETFSGKVELHGKQLEIEHSVPKKQRS RKIQIRNIPPQLRWEVLDGLLAQYGTVENCEQVNTDSETAVVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQTV QGAENGRRGGFGTRGAPRQGSPVASGAPVKQQPVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA EKAISIHSTPEGCSAACKMILEIMQKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLKKVEQDTETKITISSLQDLTL YNPERTITVKGSIDNCCRAEQEIMKKVREAYENDVAAMSLQSHLIPGLNLAAVGLFPASSNAVPPPPSSVSGAAPYNSFL PPEQETVHVFIPAQAVGAIIGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFFG PKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENEQVIVKIIGHFYASQMAQRKIRDILAQVK QQHQKGQNSQTQARRK |
|