Gene
| Gene Model ID | habu1_s1514_g05653 |
|---|---|
| Locus | habu1_scaffold1514 : 1 ... 2910 : + |
| To GenomeBrowser | habu1_scaffold1514:1..2910 |
| Genes list of scaffold | habu1_scaffold1514 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s1514_g05653.t1 | 1 | 1 | Sec62 | 1 | 63 | 8.0e-25 | 87.5 | 2.7e-28 | 8.0e-25 | 87.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s1514_g05653.t1 | gi|591361281|ref|XP_007055557.1| | PREDICTED: translocation protein SEC62 [Chelonia mydas] | 0.0 |
| habu1_s1514_g05653.t1 | gi|602670752|ref|XP_007440897.1| | PREDICTED: translocation protein SEC62 isoform X2 [Python bivittatus] | 0.0 |
| habu1_s1514_g05653.t1 | gi|564257666|ref|XP_006267782.1| | PREDICTED: translocation protein SEC62-like, partial [Alligator mississippiensis] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 24.0 |
| Venom grand-1 | 37.1 |
| Pit, infrared sensing | 23.2 |
| Nose | 31.5 |
| Brain-1 | 26.6 |
| Eye | 37.9 |
| fetal fibroblast | 41.1 |
| venom gland-2 | 101.2 |
| Brain-2 | 33.9 |
| Spleen | 35.2 |
| Lung | 32.8 |
| Liver | 67.2 |
| Kidney | 33.2 |
| Pancreas | 80.5 |
| Small intestine | 25.3 |
| Large intestine | 26.6 |
| Stomach | 38.1 |
| heart | 24.3 |
| ovary | 44.3 |
| cheek muscle | 65.6 |
Transcript
| Transcript ID | habu1_s1514_g05653.t1 |
|---|---|
| Definition | - |
>habu1_s1514_g05653.t1 cccgttgcatcctcttccttctcatctggctgatcactggaggaagacatcacttctggttcctacccaacctgactgct gacgtaggcttcattgactccttccggcccctgtacacacacgaatacaaaggaccaaaggctgactcaaagaaagagga gcgactagaaccccaaaagcagacaaaatctgacagtgaagagaaatctgatagtgagaaaaaggaagaagaggatgtca aagctgatgcccagggacgcttgggatcagaaggctctggaggagagcggaattcggatacggacagtgacaggcgggaa gatgaccggtcgcagcacagtagcggcaatgggaatgattttgaaatgatcacaaaagaggagcttgaccagcagactga tgaaggggattgtgaagaagaagaagaagatgatgatggtgaagatgaagaggaggaacaagaaagtagacctttacacg aacagtcataattcagctatcacttgggactgaatcttgtgcagaaacaattggattttctatgttggctggtgcactgg tctgacagcgttttctccccatttgcgaaagtatacagcttagccaaacatctttataaaatagttcataatttgatttg ca |
|
Protein
| Protein ID | habu1_s1514_g05653.t1 |
|---|---|
| Definition | - |
>habu1_s1514_g05653.t1 RCILFLLIWLITGGRHHFWFLPNLTADVGFIDSFRPLYTHEYKGPKADSKKEERLEPQKQTKSDSEEKSDSEKKEEEDVK ADAQGRLGSEGSGGERNSDTDSDRREDDRSQHSSGNGNDFEMITKEELDQQTDEGDCEEEEEDDDGEDEEEEQESRPLHE QS |
|