Gene
| Gene Model ID | habu1_s1518_g05673 |
|---|---|
| Locus | habu1_scaffold1518 : 61527 ... 65865 : - |
| To GenomeBrowser | habu1_scaffold1518:61527..65865 |
| Genes list of scaffold | habu1_scaffold1518 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| 4-hydroxyphenylpyruvate dioxygenase-like protein | EC:1.13.11.27 GO:0003868 GO:0006558 GO:0006570 GO:0055114 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s1518_g05673.t1 | 1 | 1 | Glyoxalase | 182 | 313 | 7.2e-10 | 38.9 | 1.7e-10 | 4.3e-07 | 29.9 |
| habu1_s1518_g05673.t1 | 1 | 1 | Glyoxalase_2 | 195 | 309 | 1.9e-07 | 31.6 | 3.0e-06 | 0.0075 | 16.8 |
| habu1_s1518_g05673.t1 | 1 | 1 | Glyoxalase_4 | 249 | 302 | 4.7e-07 | 29.7 | 8.3e-07 | 0.002 | 18.0 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s1518_g05673.t1 | gi|602626630|ref|XP_007420269.1| | PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like protein [Python bivittatus] | 0.0 |
| habu1_s1518_g05673.t1 | gi|637294574|ref|XP_008107732.1| | PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like protein [Anolis carolinensis] | 0.0 |
| habu1_s1518_g05673.t1 | gi|564258305|ref|XP_006268089.1| | PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like protein [Alligator mississippiensis] | 0.0 |
| habu1_s1518_g05673.t1 | gi|557260493|ref|XP_006015890.1| | PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like protein [Alligator sinensis] | 0.0 |
| habu1_s1518_g05673.t1 | gi|530627160|ref|XP_005303100.1| | PREDICTED: 4-hydroxyphenylpyruvate dioxygenase-like protein [Chrysemys picta bellii] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 1.3 |
| Venom grand-1 | 0.2 |
| Pit, infrared sensing | 1.7 |
| Nose | 2.1 |
| Brain-1 | 0.2 |
| Eye | 2.7 |
| fetal fibroblast | 1.1 |
| venom gland-2 | 0.4 |
| Brain-2 | 0.4 |
| Spleen | 0.9 |
| Lung | 0.3 |
| Liver | 0.0 |
| Kidney | 0.3 |
| Pancreas | 0.3 |
| Small intestine | 0.4 |
| Large intestine | 1.8 |
| Stomach | 0.6 |
| heart | 1.3 |
| ovary | 34.5 |
| cheek muscle | 0.8 |
Transcript
| Transcript ID | habu1_s1518_g05673.t1 |
|---|---|
| Definition | - |
>habu1_s1518_g05673.t1 gtcgtgagaaagttggtgttttgccgtgttctgccccaccaccgccgttatgcattcattcccggctggaaggagagaga ataataatacggcgggagaaataaggagttcagatcagatgccctgttcctctccttttctgagtgggaatattctgaga caggactacaaaatttaatagcaaaaggatgtgttgcatctaaccaaccacaaatttcacaatgtctgctgttctgaagc ggttgtgttacattggattccatgttcttcagggtcaacagctggccagtcacctggtacaaaggtttggctttgaactg tttgctatacgggaagcagagaggaagaggcagcaggctttccgaagaggagatgctatttttgttgtcaatgaagagca ggagctgactgggaaaaacttttcgtcttcagatttaccttcagactgctgtaagcataaagggatcctgtatgatgtga atctgcagtacagagtcagtacagcgtccaatatttgctttgaggtagacgatgttcctggcatctcccgaaatctacaa gagaaaggctgcaagatccttattcctccctccacagaagcagatgaaaatggctttgttacttactctgtagtgagatc cattgtgggcaacgtatgccatactcttcttgaccgatcccagtatggtgggccattcttgcctggtttctatgaagttg aagttgctcccaagaaatgccagaagaaggagaccgtacattttgaccacatcacctatgcctgtccgcaaggtagctca caggcagtgctggactggtacaaaaactgttttggtttccaccgcttcttcatccaccagcaagatgacgctgtagaagg ctttcgaattcagggggaagacatgggccttcgtcttaccgccatgcaatacagtgatgatcgattgtcactctttgagc atgactgtaaatttgttctggctgagtcactgccaaggcaaaggatgggccaggtggacactttcttacagcagcatgaa ggcgctggcatccagcatgtggccctttataccacagacattgtaagtactgctgcagccatggcaaagtcaggagtaag ctttttcaaaccaccggtatcatattacaatgagaaaagcaaagagaaggagatccagcaagttgggcaagatcttcagc tcctgaaagactacggcatccttcttgatgcgacaatagacgacgaaggacaggacgatagccctagcatgcttgagaag caatacctgatgcagatcttcactaaacctctttttacagaagagacctttttcatagagctcattgaacgccatggggc tgcaggtttcggcgagagaaatgtccgtgcgctttggaagtctgtacaggattatatggatcggcagcaaggacccactc tacttgagaacgaagcgtgacaaaatgtttattttgttctgttcagaggcgccttgaactgtgagatgggcccaaacaaa tttgataaattatagctaaacaatatagtgc |
|
Protein
| Protein ID | habu1_s1518_g05673.t1 |
|---|---|
| Definition | - |
>habu1_s1518_g05673.t1 MSAVLKRLCYIGFHVLQGQQLASHLVQRFGFELFAIREAERKRQQAFRRGDAIFVVNEEQELTGKNFSSSDLPSDCCKHK GILYDVNLQYRVSTASNICFEVDDVPGISRNLQEKGCKILIPPSTEADENGFVTYSVVRSIVGNVCHTLLDRSQYGGPFL PGFYEVEVAPKKCQKKETVHFDHITYACPQGSSQAVLDWYKNCFGFHRFFIHQQDDAVEGFRIQGEDMGLRLTAMQYSDD RLSLFEHDCKFVLAESLPRQRMGQVDTFLQQHEGAGIQHVALYTTDIVSTAAAMAKSGVSFFKPPVSYYNEKSKEKEIQQ VGQDLQLLKDYGILLDATIDDEGQDDSPSMLEKQYLMQIFTKPLFTEETFFIELIERHGAAGFGERNVRALWKSVQDYMD RQQGPTLLENEA |
|