Gene
| Gene Model ID | habu1_s17_g00115 |
|---|---|
| Locus | habu1_scaffold17 : 378636 ... 380554 : - |
| To GenomeBrowser | habu1_scaffold17:378636..380554 |
| Genes list of scaffold | habu1_scaffold17 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| peflin isoform x1 | GO:0005509 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s17_g00115.t1 | 1 | 1 | EF-hand_1 | 46 | 69 | 9.9e-06 | 24.5 | 7.2e-09 | 1.5e-05 | 23.9 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s17_g00115.t1 | gi|395526637|ref|XP_003765466.1| | PREDICTED: peflin [Sarcophilus harrisii] | 8.0e-38 |
| habu1_s17_g00115.t1 | gi|564235925|ref|XP_006274875.1| | PREDICTED: peflin [Alligator mississippiensis] | 1.0e-37 |
| habu1_s17_g00115.t1 | gi|530617479|ref|XP_005298471.1| | PREDICTED: peflin [Chrysemys picta bellii] | 7.0e-37 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 2.6 |
| Venom grand-1 | 0.5 |
| Pit, infrared sensing | 4.0 |
| Nose | 7.0 |
| Brain-1 | 4.0 |
| Eye | 4.7 |
| fetal fibroblast | 12.4 |
| venom gland-2 | 1.9 |
| Brain-2 | 3.6 |
| Spleen | 2.9 |
| Lung | 4.4 |
| Liver | 0.7 |
| Kidney | 4.3 |
| Pancreas | 0.7 |
| Small intestine | 2.5 |
| Large intestine | 2.7 |
| Stomach | 3.4 |
| heart | 3.9 |
| ovary | 13.0 |
| cheek muscle | 1.9 |
Transcript
| Transcript ID | habu1_s17_g00115.t1 |
|---|---|
| Definition | - |
>habu1_s17_g00115.t1 gatacccttcctctggcccgccgggtggaatgtatgggggtggcccagtcccaggagggtcatatggacagcctactaat ccctatggtgctccccaacctgggccctatggggcaggtggtcatggaggccacgtcccccctggcgtggatccagaagc tttctcttggttccagactgtagatgctgaccacagtggatacatcacaactaaggagctcaagcaggcccttgtcaact ccaattggtctgctttcagcgatgatacttgcttgatgatgatgagtctgattccccatcagggtttctggagctattct ctactaggatgtggccgtcagaagatcaagtacatccgttcttgacagttcagaaaagtcccgtgcaatattttctcaaa aggtggcttgtatttgaacgtgaacaaaatagattctgtggcttctcttataatttgctttttttcttgagacggtatga atacgttttttttaattttgtacccaggctagatcttcacgataaatcaaatcaacttttattatggt |
|
Protein
| Protein ID | habu1_s17_g00115.t1 |
|---|---|
| Definition | - |
>habu1_s17_g00115.t1 MYGGGPVPGGSYGQPTNPYGAPQPGPYGAGGHGGHVPPGVDPEAFSWFQTVDADHSGYITTKELKQALVNSNWSAFSDDT CLMMMSLIPHQGFWSYSLLGCGRQKIKYIRS |
|