Gene
| Gene Model ID | habu1_s1961_g07146 |
|---|---|
| Locus | habu1_scaffold1961 : 875037 ... 878138 : + |
| To GenomeBrowser | habu1_scaffold1961:875037..878138 |
| Genes list of scaffold | habu1_scaffold1961 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| alpha-crystallin b chain | GO:0001666 GO:0002088 GO:0005212 GO:0005634 GO:0005739 GO:0005829 GO:0005886 GO:0007021 GO:0007517 GO:0010629 GO:0030018 GO:0032387 GO:0042542 GO:0042803 GO:0043154 GO:0051082 GO:0051260 GO:0060561 GO:0070062 GO:0071480 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s1961_g07146.t1 | 1 | 1 | Crystallin | 1 | 52 | 3.3e-16 | 59.2 | 8.2e-20 | 6.1e-16 | 58.3 |
| habu1_s1961_g07146.t1 | 1 | 1 | HSP20 | 67 | 160 | 4.6e-25 | 87.4 | 7.8e-29 | 5.8e-25 | 87.1 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s1961_g07146.t1 | gi|602631534|ref|XP_007422667.1| | PREDICTED: alpha-crystallin B chain isoform X2 [Python bivittatus] | 0.0 |
| habu1_s1961_g07146.t1 | gi|602631532|ref|XP_007422666.1| | PREDICTED: alpha-crystallin B chain isoform X1 [Python bivittatus] | 0.0 |
| habu1_s1961_g07146.t1 | gi|530595771|ref|XP_005291443.1| | PREDICTED: alpha-crystallin B chain [Chrysemys picta bellii] | 0.0 |
| habu1_s1961_g07146.t1 | gi|532097273|ref|XP_005334292.1| | PREDICTED: alpha-crystallin B chain [Ictidomys tridecemlineatus] | 0.0 |
| habu1_s1961_g07146.t1 | gi|674049660|ref|XP_008831017.1| | PREDICTED: alpha-crystallin B chain [Nannospalax galili] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.3 |
| Venom grand-1 | 0.1 |
| Pit, infrared sensing | 5.8 |
| Nose | 0.9 |
| Brain-1 | 4.5 |
| Eye | 73.8 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.0 |
| Brain-2 | 10.6 |
| Spleen | 0.0 |
| Lung | 0.6 |
| Liver | 0.0 |
| Kidney | 1.0 |
| Pancreas | 0.0 |
| Small intestine | 0.0 |
| Large intestine | 0.1 |
| Stomach | 0.0 |
| heart | 3.3 |
| ovary | 0.1 |
| cheek muscle | 3.6 |
Transcript
| Transcript ID | habu1_s1961_g07146.t1 |
|---|---|
| Definition | - |
>habu1_s1961_g07146.t1 cactgccaccggccgcttccttgggggagatggacgtctccatccaccaccccttcttccgcagacggctcttgcccggc ctctcgcccagccgcctcttcggccaacattttggggatcccgtcatggaatccgaactcttcacaggcagctggcccct gggctccttcctggcgaggcccttcgccttcaggaacgcgggatggatggacagcggacttcccgagatgcgtttggaca acgatcagttttccgtcaacctggacgtgaagcagttttctcccgaggagctgaaggtcaaggtttggggagacatgatt gaagtccaggggaagcatgaggagcgccaggacaggcagggctccgtcgcccgcgagttcagcaggaagtacagaatccc agccgacgtggaccccctcaccatcacctcctccctctcttcggatggcatcctgacggtgagcggaccaaggaaactca aggaacttccgcagcgcagcatccccgtcatgcgggaagaaagatcggcccttgtgccaggaccaaggaaatagaggccc ctggaaggcccgccctttccaccccgaagaaagcctttccctgggacagaaacggcaaattggttcttcttctttattta tctgtgcaaagataggcactctttactaacaaataaacaggtgggaccttcccccccct |
|
Protein
| Protein ID | habu1_s1961_g07146.t1 |
|---|---|
| Definition | - |
>habu1_s1961_g07146.t1 MDVSIHHPFFRRRLLPGLSPSRLFGQHFGDPVMESELFTGSWPLGSFLARPFAFRNAGWMDSGLPEMRLDNDQFSVNLDV KQFSPEELKVKVWGDMIEVQGKHEERQDRQGSVAREFSRKYRIPADVDPLTITSSLSSDGILTVSGPRKLKELPQRSIPV MREERSALVPGPRK |
|