Gene
| Gene Model ID | habu1_s1961_g07147 |
|---|---|
| Locus | habu1_scaffold1961 : 878271 ... 881316 : - |
| To GenomeBrowser | habu1_scaffold1961:878271..881316 |
| Genes list of scaffold | habu1_scaffold1961 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| upf0686 protein c11orf1 homolog | GO:0005634 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s1961_g07147.t1 | 1 | 1 | DUF1143 | 3 | 131 | 0.0 | 205.9 | 0.0 | 0.0 | 205.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s1961_g07147.t1 | gi|602631536|ref|XP_007422668.1| | PREDICTED: UPF0686 protein C11orf1 homolog [Python bivittatus] | 0.0 |
| habu1_s1961_g07147.t1 | gi|637356208|ref|XP_008119280.1| | PREDICTED: UPF0686 protein C11orf1 homolog [Anolis carolinensis] | 0.0 |
| habu1_s1961_g07147.t1 | gi|557288005|ref|XP_006026701.1| | PREDICTED: UPF0686 protein C11orf1 homolog isoform X1 [Alligator sinensis] | 0.0 |
| habu1_s1961_g07147.t1 | gi|591371464|ref|XP_007060545.1| | PREDICTED: UPF0686 protein C11orf1 homolog [Chelonia mydas] | 0.0 |
| habu1_s1961_g07147.t1 | gi|557288007|ref|XP_006026702.1| | PREDICTED: UPF0686 protein C11orf1 homolog isoform X2 [Alligator sinensis] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 1.5 |
| Venom grand-1 | 3.2 |
| Pit, infrared sensing | 1.9 |
| Nose | 3.4 |
| Brain-1 | 0.6 |
| Eye | 2.6 |
| fetal fibroblast | 0.9 |
| venom gland-2 | 4.3 |
| Brain-2 | 1.8 |
| Spleen | 2.4 |
| Lung | 3.9 |
| Liver | 10.2 |
| Kidney | 21.7 |
| Pancreas | 6.7 |
| Small intestine | 8.3 |
| Large intestine | 4.8 |
| Stomach | 9.2 |
| heart | 2.1 |
| ovary | 11.1 |
| cheek muscle | 5.6 |
Transcript
| Transcript ID | habu1_s1961_g07147.t1 |
|---|---|
| Definition | - |
>habu1_s1961_g07147.t1 agtagttccaacatcaccactacaacttctgattccgaggatatgtccctgtcgtgcttctttaaccctcttcatggctg cttgctccacgcagacggccacggggaggtgtggacagactggaacagcacatcaaaattcttccagtatgggtggaggt gcaccaccaacgaggacatgtatgccaacaaaaccctcttggggaactggaatgaggagcgttacgatatccagaaaagg aggcaactcaaacctcttccttcccagtacggtcactatttcgagtccacgtacgggtcagactattccaaggaaatgcc tcgcagattaagaagggtgacgcgagagcctcactggttccccggacaccagcctgagctggagccccctccgatcaagc ccaccgctcggtcgtgctacatgatcgactacaagcctccgcacggcagggcagtctgctctctggccgaagggaagccc aaggcaacagaggaaacgccgctgaagcagtaggccgctgctccaggatcacccggggggtggaaatctctgctgggagg tctcctcgccccaccacgaagactagaagcctgcttgctgggcggaagttcctaaaataaaagaaatgcttgccaggaga ccc |
|
Protein
| Protein ID | habu1_s1961_g07147.t1 |
|---|---|
| Definition | - |
>habu1_s1961_g07147.t1 MSLSCFFNPLHGCLLHADGHGEVWTDWNSTSKFFQYGWRCTTNEDMYANKTLLGNWNEERYDIQKRRQLKPLPSQYGHYF ESTYGSDYSKEMPRRLRRVTREPHWFPGHQPELEPPPIKPTARSCYMIDYKPPHGRAVCSLAEGKPKATEETPLKQ |
|