Gene
| Gene Model ID | habu1_s2255_g08044 |
|---|---|
| Locus | habu1_scaffold2255 : 172886 ... 179386 : + |
| To GenomeBrowser | habu1_scaffold2255:172886..179386 |
| Genes list of scaffold | habu1_scaffold2255 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| gastrin-releasing peptide | GO:0007218 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s2255_g08044.t1 | 1 | 1 | Bombesin | 59 | 72 | 1.3e-08 | 33.9 | 1.4e-12 | 2.0e-08 | 33.3 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2255_g08044.t1 | gi|602629706|ref|XP_007421777.1| | PREDICTED: gastrin-releasing peptide [Python bivittatus] | 0.0 |
| habu1_s2255_g08044.t1 | gi|637342761|ref|XP_008116806.1| | PREDICTED: gastrin-releasing peptide [Anolis carolinensis] | 0.0 |
| habu1_s2255_g08044.t1 | gi|641796410|ref|XP_008161587.1| | PREDICTED: gastrin-releasing peptide isoform X1 [Chrysemys picta bellii] | 0.0 |
| habu1_s2255_g08044.t1 | gi|641796412|ref|XP_008161588.1| | PREDICTED: gastrin-releasing peptide isoform X2 [Chrysemys picta bellii] | 0.0 |
| habu1_s2255_g08044.t1 | gi|675403353|ref|XP_008917694.1| | PREDICTED: gastrin-releasing peptide, partial [Manacus vitellinus] | 1.0e-37 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 2.5 |
| Venom grand-1 | 1.5 |
| Pit, infrared sensing | 12.3 |
| Nose | 30.3 |
| Brain-1 | 7.1 |
| Eye | 17.2 |
| fetal fibroblast | 2.1 |
| venom gland-2 | 1.4 |
| Brain-2 | 13.5 |
| Spleen | 91.6 |
| Lung | 4.5 |
| Liver | 8.0 |
| Kidney | 2.3 |
| Pancreas | 2.9 |
| Small intestine | 20.4 |
| Large intestine | 20.9 |
| Stomach | 11.3 |
| heart | 1.6 |
| ovary | 23.1 |
| cheek muscle | 1.8 |
Transcript
| Transcript ID | habu1_s2255_g08044.t1 |
|---|---|
| Definition | - |
>habu1_s2255_g08044.t1 ggactctgccccgcgaaatcctccactcgcaccgatggcccgcccgatggagaccttgcagctcctgccgaagccccgcg ggcagctccaactcttcccgctcctggctctcgtcgccttcgcgctgctcctgcaagggcgcggcgggcgcgcggcttct ttgcagggcgtcgacggagcgtccccgatggccaagatctacccccgagggagccactgggccgtgggtcacttcatggg gaaaaagagtactggagattttccttacatatatgaagaaggtcaacggatgcccttctctttgctgccagataatgcca aacagctgggcagctatttgcagcaggatgaatccttcaaggagctgctcaaacgtatggaagaggaggggggtcaaaat actcaggttctccgggaagagctgccattttcttccaagaacgattgggggacagaggaaaccggcaacttcaaagatat gatggagctcctgctgcaagcactggatagaaaggaaagcagtccaagttgaaataactgccctccagcactgaagacat agaataatgtctttaagagactattgtttcataagcattttattgtacacgataactaaataattatcttttctgttaaa acaagattttttttcccttcggtgtaaaagaacctgtttacttgttctcccaacaatggctacacttttccagtggcttt ttcctctttctaagcatttttctcacttgaattgctttgttgtacataattgtcaatgaagggtcttccaattctctgac aatactttgccattttctctcttcaatcactgcatcttttatcttacgatcatcctgcatttcaatatccacaataaata aatatatatttaacaaaaaaaggt |
|
Protein
| Protein ID | habu1_s2255_g08044.t1 |
|---|---|
| Definition | - |
>habu1_s2255_g08044.t1 MARPMETLQLLPKPRGQLQLFPLLALVAFALLLQGRGGRAASLQGVDGASPMAKIYPRGSHWAVGHFMGKKSTGDFPYIY EEGQRMPFSLLPDNAKQLGSYLQQDESFKELLKRMEEEGGQNTQVLREELPFSSKNDWGTEETGNFKDMMELLLQALDRK ESSPS |
|