Gene
| Gene Model ID | habu1_s2255_g08055 |
|---|---|
| Locus | habu1_scaffold2255 : 1033153 ... 1063957 : + |
| To GenomeBrowser | habu1_scaffold2255:1033153..1063957 |
| Genes list of scaffold | habu1_scaffold2255 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| phospholipid-transporting atpase vb | EC:2.7.7.49 EC:3.6.3.1 GO:0000287 GO:0003723 GO:0003964 GO:0004012 GO:0005524 GO:0006278 GO:0006812 GO:0015917 GO:0016021 GO:0045332 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2255_g08055.t1 | gi|591388156|ref|XP_007068491.1| | PREDICTED: trypsin I-P1-like [Chelonia mydas] | 7.0e-07 |
| habu1_s2255_g08055.t1 | gi|701411084|ref|XP_009971261.1| | PREDICTED: dipeptidyl aminopeptidase-like protein 6, partial [Tyto alba] | 9.0e-06 |
| habu1_s2255_g08055.t1 | gi|700374501|ref|XP_009937075.1| | PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104333292, partial [Opisthocomus hoazin] | 1.0e-05 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.7 |
| Venom grand-1 | 0.8 |
| Pit, infrared sensing | 1.0 |
| Nose | 0.9 |
| Brain-1 | 1.0 |
| Eye | 0.6 |
| fetal fibroblast | 0.4 |
| venom gland-2 | 3.4 |
| Brain-2 | 1.7 |
| Spleen | 1.0 |
| Lung | 1.4 |
| Liver | 1.9 |
| Kidney | 0.8 |
| Pancreas | 3.0 |
| Small intestine | 1.8 |
| Large intestine | 2.0 |
| Stomach | 0.5 |
| heart | 1.1 |
| ovary | 0.1 |
| cheek muscle | 0.2 |
Transcript
| Transcript ID | habu1_s2255_g08055.t1 |
|---|---|
| Definition | - |
>habu1_s2255_g08055.t1 caaccggttgtaagtcgaggactttccctgcccgggagcgccgcgcatgcgtggttccgccccctgcgccagccgaggcg tagctggcaagcggcagagacggagcaggccgaccaccaactggcccagcccaagggaatctatcacttggaatactgca tccagtttacgatgtaaaaaagatgttgagactctagaaagagtacagagaagagcaacaaagatgattaggggactgga ggctaaagcatataaggaaaggctgctggaattgggcccagtaggaacttctggaagcggcatccacacagagaaccggt tgttcacatatttgaatcccaccactgggatgctgcagtcgttgtgccttacctcccttgggctgggccagctggtggtc ggcctgctccgtctctgccgcttgccagctatgcctcagccggcgcagggggcggaaccacgcatgcgcagcgttcccgg gcagggaaagtcctcgacttacgaccggttgggtagtcctcgacttacgaccggtttagtcctcgacttacgactggttt agtcctcgacttatgaccggtttagtcctcgacttatgaccagttggggtcgcggcattaaaaaggttgagaaccactgg ctta |
|
Protein
| Protein ID | habu1_s2255_g08055.t1 |
|---|---|
| Definition | - |
>habu1_s2255_g08055.t1 MRGSAPCASRGVAGKRQRRSRPTTNWPSPRESITWNTASSLRCKKDVETLERVQRRATKMIRGLEAKAYKERLLELGPVG TSGSGIHTENRLFTYLNPTTGMLQSLCLTSLGLGQLVVGLLRLCRLPAMPQPAQGAEPRMRSVPGQGKSSTYDRLGSPRL TTGLVLDLRLV |
|