Gene
| Gene Model ID | habu1_s2255_g08060 |
|---|---|
| Locus | habu1_scaffold2255 : 1335208 ... 1356653 : - |
| To GenomeBrowser | habu1_scaffold2255:1335208..1356653 |
| Genes list of scaffold | habu1_scaffold2255 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| a disintegrin and metalloproteinase with thrombospondin motifs 12- partial | EC:3.4.24.0 GO:0004222 GO:0005578 GO:0006508 GO:0007229 GO:0008270 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s2255_g08060.t1 | 1 | 1 | ADAM_spacer1 | 130 | 224 | 1.4e-28 | 99.0 | 1.3e-32 | 1.9e-28 | 98.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2255_g08060.t1 | gi|699585338|ref|XP_009864410.1| | PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 12-like, partial [Apaloderma vittatum] | 0.0 |
| habu1_s2255_g08060.t1 | gi|675629811|ref|XP_008943414.1| | PREDICTED: LOW QUALITY PROTEIN: A disintegrin and metalloproteinase with thrombospondin motifs 12-like, partial [Merops nubicus] | 0.0 |
| habu1_s2255_g08060.t1 | gi|723147096|ref|XP_010290798.1| | PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 12-like, partial [Phaethon lepturus] | 0.0 |
| habu1_s2255_g08060.t1 | gi|700421999|ref|XP_009949278.1| | PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 12-like, partial [Leptosomus discolor] | 0.0 |
| habu1_s2255_g08060.t1 | gi|677971915|ref|XP_009071313.1| | PREDICTED: A disintegrin and metalloproteinase with thrombospondin motifs 12-like, partial [Acanthisitta chloris] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.6 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 0.7 |
| Nose | 0.1 |
| Brain-1 | 0.2 |
| Eye | 0.0 |
| fetal fibroblast | 0.7 |
| venom gland-2 | 0.0 |
| Brain-2 | 0.2 |
| Spleen | 0.1 |
| Lung | 0.0 |
| Liver | 0.4 |
| Kidney | 0.4 |
| Pancreas | 0.0 |
| Small intestine | 0.2 |
| Large intestine | 0.3 |
| Stomach | 0.1 |
| heart | 0.0 |
| ovary | 0.2 |
| cheek muscle | 0.6 |
Transcript
| Transcript ID | habu1_s2255_g08060.t1 |
|---|---|
| Definition | - |
>habu1_s2255_g08060.t1 accacagtttggagggaagtattgcactggagagagaaagcgctatcatatgtgcaatgttaaagggtgccaaaaggcaa ccccaaatttccgtcagatgcagtgcagcgagtttgatacagttgcctacaaaaatgaattctaccaatggatcccagtt tataataaagttagtccctgtgagctgcaatgccgccctacaaaccaccatttttcggataagatgttagatgctgtaat tgatggtacaccttgttttgaaggaaaccgctacagagatgtctgcattaatggcatgtgtaagactgttggctgtgatt atgaaattaattccaatgccactgaagatcagtgtggagtttgcttaggagatggatcttcttgccggacagtgaagata acattcaatcagagtgaaggattaggttatgttgacattggcctgattcccaaaggtgcaaggcacatcaaagtggttga agtgtcagaggcaggcaatttccttgctctgcgcagtgaagatcctcagaagtactatctaaatggagggtttattattc agtggaatggagattacgaagtggcaggaacaatatttaagtatggaagaaaaggagatttggaaaacctcactgcttct ggacccacaaatgaatccttgtggctgcaggtacgtcagaatgtcaggtattgatatgttgtccaatgcattaataaatg atcacattgatacatctggt |
|
Protein
| Protein ID | habu1_s2255_g08060.t1 |
|---|---|
| Definition | - |
>habu1_s2255_g08060.t1 PQFGGKYCTGERKRYHMCNVKGCQKATPNFRQMQCSEFDTVAYKNEFYQWIPVYNKVSPCELQCRPTNHHFSDKMLDAVI DGTPCFEGNRYRDVCINGMCKTVGCDYEINSNATEDQCGVCLGDGSSCRTVKITFNQSEGLGYVDIGLIPKGARHIKVVE VSEAGNFLALRSEDPQKYYLNGGFIIQWNGDYEVAGTIFKYGRKGDLENLTASGPTNESLWLQVRQNVRY |
|