Gene
| Gene Model ID | habu1_s2279_g08243 |
|---|---|
| Locus | habu1_scaffold2279 : 775695 ... 778990 : - |
| To GenomeBrowser | habu1_scaffold2279:775695..778990 |
| Genes list of scaffold | habu1_scaffold2279 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| trimeric intracellular cation channel type a | GO:0005267 GO:0016021 GO:0031965 GO:0033017 GO:0070062 GO:0071805 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2279_g08243.t1 | gi|699632148|ref|XP_009908139.1| | PREDICTED: trimeric intracellular cation channel type A [Picoides pubescens] | 4.0e-14 |
| habu1_s2279_g08243.t1 | gi|530565045|ref|XP_005279091.1| | PREDICTED: trimeric intracellular cation channel type A [Chrysemys picta bellii] | 2.0e-13 |
| habu1_s2279_g08243.t1 | gi|119331148|ref|NP_001073226.1| | trimeric intracellular cation channel type A [Gallus gallus] | 2.0e-13 |
| habu1_s2279_g08243.t1 | gi|543376163|ref|XP_005531290.1| | PREDICTED: trimeric intracellular cation channel type A [Pseudopodoces humilis] | 2.0e-12 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.0 |
| Venom grand-1 | 0.3 |
| Pit, infrared sensing | 0.0 |
| Nose | 0.0 |
| Brain-1 | 0.0 |
| Eye | 0.0 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.0 |
| Brain-2 | 0.2 |
| Spleen | 0.0 |
| Lung | 0.0 |
| Liver | 0.0 |
| Kidney | 0.0 |
| Pancreas | 0.0 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 6.9 |
Transcript
| Transcript ID | habu1_s2279_g08243.t1 |
|---|---|
| Definition | - |
>habu1_s2279_g08243.t1 gcccgctcggttctccttccgacaatggacctgatcggggccctggatgtgggggatttggcggccgccttcgcccacct gcctgtcttccccgtcttcgacttgggctacttcgtagtctctctcctctacctcaagtatgagaaagcatgtatggaaa agaaaaggaaaggaaaggaaaggaaaacaatactcactttagaccgaatctttattcttggtgactacctggaaatatcc atataattttctttacaatagtgtggaaatgtttgctatttccttcctttgggaatgtcactcagaaatcaagtgcaaac ctcaccctaaaagacaatatttgcacacctccttcctgaataaaagaaaccaaagttcaaatgttt |
|
Protein
| Protein ID | habu1_s2279_g08243.t1 |
|---|---|
| Definition | - |
>habu1_s2279_g08243.t1 MDLIGALDVGDLAAAFAHLPVFPVFDLGYFVVSLLYLKYEKACMEKKRKGKERKTILTLDRIFILGDYLEISI |
|