Gene
| Gene Model ID | habu1_s2279_g08244 |
|---|---|
| Locus | habu1_scaffold2279 : 779481 ... 785980 : + |
| To GenomeBrowser | habu1_scaffold2279:779481..785980 |
| Genes list of scaffold | habu1_scaffold2279 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| small integral membrane protein 7 isoform x3 | GO:0016021 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2279_g08244.t1 | gi|602635365|ref|XP_007424549.1| | PREDICTED: small integral membrane protein 7 [Python bivittatus] | 2.8026e-45 |
| habu1_s2279_g08244.t1 | gi|119604964|gb|EAW84558.1| | hypothetical protein MGC2747, isoform CRA_c [Homo sapiens] | 1.99965e-42 |
| habu1_s2279_g08244.t1 | gi|348556970|ref|XP_003464293.1| | PREDICTED: small integral membrane protein 7 [Cavia porcellus] | 3.00018e-42 |
| habu1_s2279_g08244.t1 | gi|742149236|ref|XP_010843907.1| | PREDICTED: small integral membrane protein 7 [Bison bison bison] | 3.99931e-42 |
| habu1_s2279_g08244.t1 | gi|674098828|ref|XP_008822871.1| | PREDICTED: small integral membrane protein 7 [Nannospalax galili] | 3.99931e-42 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 23.1 |
| Venom grand-1 | 24.1 |
| Pit, infrared sensing | 24.9 |
| Nose | 22.9 |
| Brain-1 | 10.5 |
| Eye | 15.5 |
| fetal fibroblast | 26.5 |
| venom gland-2 | 33.8 |
| Brain-2 | 11.0 |
| Spleen | 7.2 |
| Lung | 19.1 |
| Liver | 25.4 |
| Kidney | 52.0 |
| Pancreas | 14.3 |
| Small intestine | 8.4 |
| Large intestine | 15.1 |
| Stomach | 15.6 |
| heart | 14.1 |
| ovary | 6.7 |
| cheek muscle | 22.4 |
Transcript
| Transcript ID | habu1_s2279_g08244.t1 |
|---|---|
| Definition | - |
>habu1_s2279_g08244.t1 gagcgagagtggggcagcagaagcaaatgcaaccagttgccagggcgatgtagtgccacctggcggccagcggttggaat ggcaagatgaagttgggtgtttattggatgttgagccgctgcgtgtcaaccgggtatatttccgtttcgatagcagcaga gcggaagtagcaggatgttgggggatttgctgttgttcgggactctgttggtcaatgccggagcagtgttaaatttcagg ctgaagaagaaagagagtcagggctttggtgaagaaggaagagaaccaacaacaggtgataatatcagggagtttctgtt gagtttaagatactttcggatcttcatcgcactgtggaatattttcatgatgttttgcatgattgtgctgtttggatctt aaacaactttgactgaactgacaaaaaatacacgtaaatctttggcaatttgcagatggcttccaactggaaatataaaa tactcctaagtaaaagatttg |
|
Protein
| Protein ID | habu1_s2279_g08244.t1 |
|---|---|
| Definition | - |
>habu1_s2279_g08244.t1 MLGDLLLFGTLLVNAGAVLNFRLKKKESQGFGEEGREPTTGDNIREFLLSLRYFRIFIALWNIFMMFCMIVLFGS |
|