Gene
| Gene Model ID | habu1_s2279_g08257 |
|---|---|
| Locus | habu1_scaffold2279 : 1074417 ... 1077008 : - |
| To GenomeBrowser | habu1_scaffold2279:1074417..1077008 |
| Genes list of scaffold | habu1_scaffold2279 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| cwf19-like protein 1 | GO:0003824 GO:0008152 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2279_g08257.t1 | gi|426365876|ref|XP_004049992.1| | PREDICTED: CWF19-like protein 1 [Gorilla gorilla gorilla] | 2.0e-26 |
| habu1_s2279_g08257.t1 | gi|116283772|gb|AAH27553.1| | Cwf19l1 protein, partial [Mus musculus] | 1.0e-25 |
| habu1_s2279_g08257.t1 | gi|397510249|ref|XP_003825513.1| | PREDICTED: CWF19-like protein 1 isoform X2 [Pan paniscus] | 2.0e-25 |
| habu1_s2279_g08257.t1 | gi|525343979|ref|NP_001267153.1| | CWF19-like protein 1 [Pan troglodytes] | 2.0e-25 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.8 |
| Venom grand-1 | 0.5 |
| Pit, infrared sensing | 2.3 |
| Nose | 1.2 |
| Brain-1 | 2.0 |
| Eye | 0.9 |
| fetal fibroblast | 3.1 |
| venom gland-2 | 0.5 |
| Brain-2 | 2.8 |
| Spleen | 1.7 |
| Lung | 1.5 |
| Liver | 0.0 |
| Kidney | 1.0 |
| Pancreas | 6.7 |
| Small intestine | 0.4 |
| Large intestine | 1.1 |
| Stomach | 0.2 |
| heart | 1.6 |
| ovary | 2.3 |
| cheek muscle | 2.7 |
Transcript
| Transcript ID | habu1_s2279_g08257.t1 |
|---|---|
| Definition | - |
>habu1_s2279_g08257.t1 ccggcggagcagtttgcttgtgacacagcgcccgagaaggcgggcggaagcgaggcgccgcggttgtgatggcgccggag aagcctttgcgcctgttggcctgtggagatgtagaaggaaaatttggaactttatattccagagttcaagctgttcagaa gaaaagtggagcatttgatttccttttgtgtgtgggaaacttctttggctctgctcaagattcagaatggaaagattatc aaacaggagcaaaaaagggtactttatcccacgtttttgaaccaaaatatttctcttctattccctactcccactgatac tttgatcacaaattaaatgtgcatactgctggttttcatatcaaaataaacatcttattattttaatatgta |
|
Protein
| Protein ID | habu1_s2279_g08257.t1 |
|---|---|
| Definition | - |
>habu1_s2279_g08257.t1 MAPEKPLRLLACGDVEGKFGTLYSRVQAVQKKSGAFDFLLCVGNFFGSAQDSEWKDYQTGAKKGTLSHVFEPKYFSSIPY SH |
|