Gene
| Gene Model ID | habu1_s2279_g08263 |
|---|---|
| Locus | habu1_scaffold2279 : 1701718 ... 1704958 : - |
| To GenomeBrowser | habu1_scaffold2279:1701718..1704958 |
| Genes list of scaffold | habu1_scaffold2279 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2279_g08263.t1 | gi|697820439|ref|XP_009646589.1| | PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RNF213-like [Egretta garzetta] | 2.0e-09 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.0 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 0.0 |
| Nose | 0.0 |
| Brain-1 | 0.0 |
| Eye | 0.0 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.0 |
| Brain-2 | 0.0 |
| Spleen | 0.0 |
| Lung | 0.0 |
| Liver | 0.0 |
| Kidney | 0.0 |
| Pancreas | 0.0 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 0.0 |
Transcript
| Transcript ID | habu1_s2279_g08263.t1 |
|---|---|
| Definition | - |
>habu1_s2279_g08263.t1 cggtcgtaagtcgaggactacccaactggtcataagtcgaggactttccctgcccgggagcgccgcacatgcatggttct gccccctgcgccggccgaggcatagctggcaagcggcagagacggagcaggccgaccaccagctggcccagcccaaggga ggtgacaaaattagtggaccagaagaatgctgtggatatcatttacttggacttcaataataataaagtagatcataacc tactagttgtgctcttcaacatcttcatcaatgatttggatgaggggatagatggggaattcatcaaatttgcagacaac actaaactggtaggaatagccaacactccagaagataggcttatgatacagaaggatcttgacagaaaaattgggaaaat agaaggaaaggatatcaagtaggtttgttgcctcaagttatttataagcagtaataaacatcaaataaataaaagaaagc |
|
Protein
| Protein ID | habu1_s2279_g08263.t1 |
|---|---|
| Definition | - |
>habu1_s2279_g08263.t1 MHGSAPCAGRGIAGKRQRRSRPTTSWPSPREVTKLVDQKNAVDIIYLDFNNNKVDHNLLVVLFNIFINDLDEGIDGEFIK FADNTKLVGIANTPEDRLMIQKDLDRKIGKIEGKDIK |
|