Gene
| Gene Model ID | habu1_s2370_g08597 |
|---|---|
| Locus | habu1_scaffold2370 : 88133 ... 89985 : - |
| To GenomeBrowser | habu1_scaffold2370:88133..89985 |
| Genes list of scaffold | habu1_scaffold2370 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| proline-rich protein prcc | GO:0005515 GO:0005654 GO:0007093 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s2370_g08597.t1 | 1 | 1 | PRCC | 5 | 100 | 1.1e-23 | 84.8 | 8.5e-28 | 1.3e-23 | 84.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2370_g08597.t1 | gi|637361231|ref|XP_008120247.1| | PREDICTED: proline-rich protein PRCC [Anolis carolinensis] | 0.0 |
| habu1_s2370_g08597.t1 | gi|119573293|gb|EAW52908.1| | papillary renal cell carcinoma (translocation-associated), isoform CRA_a [Homo sapiens] | 0.0 |
| habu1_s2370_g08597.t1 | gi|558120399|ref|XP_006114025.1| | PREDICTED: proline-rich protein PRCC, partial [Pelodiscus sinensis] | 0.0 |
| habu1_s2370_g08597.t1 | gi|641791499|ref|XP_008177270.1| | PREDICTED: proline-rich protein PRCC [Chrysemys picta bellii] | 0.0 |
| habu1_s2370_g08597.t1 | gi|395532256|ref|XP_003768187.1| | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 22.1 |
| Venom grand-1 | 28.5 |
| Pit, infrared sensing | 22.8 |
| Nose | 20.3 |
| Brain-1 | 16.6 |
| Eye | 22.6 |
| fetal fibroblast | 31.3 |
| venom gland-2 | 36.6 |
| Brain-2 | 15.6 |
| Spleen | 18.9 |
| Lung | 25.4 |
| Liver | 23.2 |
| Kidney | 22.2 |
| Pancreas | 18.8 |
| Small intestine | 20.5 |
| Large intestine | 25.2 |
| Stomach | 20.4 |
| heart | 18.4 |
| ovary | 24.3 |
| cheek muscle | 52.6 |
Transcript
| Transcript ID | habu1_s2370_g08597.t1 |
|---|---|
| Definition | - |
>habu1_s2370_g08597.t1 ggcgggggctactacccggagagcgacccgggcttggggccgccccccgagggcagcgcggacgccgccccctcctcctt catggacgacgaagcgttcaagcgtctgcaaggcaagcgcaaccgggggcgagaagagatcaacttcgtggagatcaagg gcgacgaccagctgagcggagtccagcagtggctcaccaagtccctgaccgaggagcagaatatgaagtccttcagcaag aaaaagggggagcagcccacagggcagcagcgaaggaagcaccagatcacctacctgattcaccaggcgaaagaacggga gctggagctgaagaacagctgggcagagaacaagctgagccggcgccagacccaggccaaattgtagccgtttccccgtt cagcagacagacatccatctttgcggcagagtatctgtatttagggggggtgttttttctaaaaaaagaccttggtttat ttccctggacactttagtacttaggaaggctccctgtccctattttgaatatttgaaaataaagctcattccgtaattgc tttgt |
|
Protein
| Protein ID | habu1_s2370_g08597.t1 |
|---|---|
| Definition | - |
>habu1_s2370_g08597.t1 MDDEAFKRLQGKRNRGREEINFVEIKGDDQLSGVQQWLTKSLTEEQNMKSFSKKKGEQPTGQQRRKHQITYLIHQAKERE LELKNSWAENKLSRRQTQAKL |
|