Gene
| Gene Model ID | habu1_s2396_g08730 |
|---|---|
| Locus | habu1_scaffold2396 : 20126 ... 68775 : - |
| To GenomeBrowser | habu1_scaffold2396:20126..68775 |
| Genes list of scaffold | habu1_scaffold2396 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| camp-specific 3 -cyclic phosphodiesterase 4d-like isoform x5 | GO:0005634 GO:0005667 GO:0005737 GO:0008140 GO:0032793 GO:0045941 GO:0051289 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2396_g08730.t1 | gi|528493552|ref|XP_005172887.1| | PREDICTED: cAMP-specific 3',5'-cyclic phosphodiesterase 4C isoform X1 [Danio rerio] | 1.0e-24 |
| habu1_s2396_g08730.t1 | gi|499028278|ref|XP_004564866.1| | 6.0e-24 | |
| habu1_s2396_g08730.t1 | gi|548356297|ref|XP_005730276.1| | PREDICTED: cAMP-specific 3',5'-cyclic phosphodiesterase 4D-like isoform X5 [Pundamilia nyererei] | 6.0e-24 |
| habu1_s2396_g08730.t1 | gi|554849354|ref|XP_005934968.1| | PREDICTED: cAMP-specific 3',5'-cyclic phosphodiesterase 4D-like isoform X3 [Haplochromis burtoni] | 7.0e-24 |
| habu1_s2396_g08730.t1 | gi|548356293|ref|XP_005730274.1| | PREDICTED: cAMP-specific 3',5'-cyclic phosphodiesterase 4D-like isoform X3 [Pundamilia nyererei] | 8.0e-24 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.0 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 0.0 |
| Nose | 0.0 |
| Brain-1 | 0.9 |
| Eye | 0.0 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.0 |
| Brain-2 | 0.6 |
| Spleen | 0.5 |
| Lung | 0.0 |
| Liver | 0.0 |
| Kidney | 0.0 |
| Pancreas | 0.0 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 0.0 |
Transcript
| Transcript ID | habu1_s2396_g08730.t1 |
|---|---|
| Definition | - |
>habu1_s2396_g08730.t1 ggagcgcggagaagggcagagggccagttcggaggagccaaggctgggcggccccggcgaaactttgcccgactgtgcct tcctcgccggcccttctctgcctcttcgcttcgccgggctccacgtggccgtttcagcaccacgcgatggaggagagcgc cgcgcgccgccccttggagctgagccgcgaaggagccggcctggccaagccgcccaagcacctctggcgccagcctcgca cccacatccgcatcaagcagcgtttccactccgacactgagaagtacctgcgctcgggaaccggcgatgccgcgttccgg cccgccctccgaaaccccaggatgtcctggccctcctcgctgtaccgccgggaagtattgatgtgtgatattgatagaag agtcaaatattctgcttaattaaattgtaggaacccaaatcatttagctatggagattaaaaataaataaatgcaatctt attaagtggaaca |
|
Protein
| Protein ID | habu1_s2396_g08730.t1 |
|---|---|
| Definition | - |
>habu1_s2396_g08730.t1 MEESAARRPLELSREGAGLAKPPKHLWRQPRTHIRIKQRFHSDTEKYLRSGTGDAAFRPALRNPRMSWPSSLYRREVLMC DIDRRVKYSA |
|