Gene
| Gene Model ID | habu1_s24_g00212 |
|---|---|
| Locus | habu1_scaffold24 : 536894 ... 576637 : + |
| To GenomeBrowser | habu1_scaffold24:536894..576637 |
| Genes list of scaffold | habu1_scaffold24 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| dep domain-containing mtor-interacting protein | GO:0005622 GO:0006469 GO:0032007 GO:0045792 GO:2001236 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s24_g00212.t1 | 2 | 1 | DEP | 34 | 101 | 9.80909e-45 | 150.1 | 1.7e-27 | 2.5e-23 | 81.6 |
| habu1_s24_g00212.t1 | 2 | 2 | DEP | 146 | 213 | 9.80909e-45 | 150.1 | 3.4e-23 | 5.0e-19 | 67.8 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s24_g00212.t1 | gi|327280280|ref|XP_003224880.1| | PREDICTED: DEP domain-containing mTOR-interacting protein [Anolis carolinensis] | 0.0 |
| habu1_s24_g00212.t1 | gi|224046669|ref|XP_002199327.1| | PREDICTED: DEP domain-containing mTOR-interacting protein [Taeniopygia guttata] | 0.0 |
| habu1_s24_g00212.t1 | gi|704177614|ref|XP_010134164.1| | PREDICTED: DEP domain-containing mTOR-interacting protein, partial [Buceros rhinoceros silvestris] | 0.0 |
| habu1_s24_g00212.t1 | gi|686598653|ref|XP_009275489.1| | PREDICTED: DEP domain-containing mTOR-interacting protein [Aptenodytes forsteri] | 0.0 |
| habu1_s24_g00212.t1 | gi|313747499|ref|NP_001186431.1| | DEP domain-containing mTOR-interacting protein [Gallus gallus] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 1.2 |
| Venom grand-1 | 3.1 |
| Pit, infrared sensing | 3.4 |
| Nose | 1.2 |
| Brain-1 | 2.8 |
| Eye | 2.9 |
| fetal fibroblast | 0.6 |
| venom gland-2 | 6.9 |
| Brain-2 | 3.9 |
| Spleen | 4.7 |
| Lung | 6.1 |
| Liver | 56.3 |
| Kidney | 38.8 |
| Pancreas | 12.1 |
| Small intestine | 7.2 |
| Large intestine | 26.1 |
| Stomach | 7.9 |
| heart | 13.7 |
| ovary | 2.1 |
| cheek muscle | 7.6 |
Transcript
| Transcript ID | habu1_s24_g00212.t1 |
|---|---|
| Definition | - |
>habu1_s24_g00212.t1 gattcttttcacattgccggctatgggtaaatcattaaattgatgatatctggatttcagatccaaatcgacagtagata tctggatcagtcaaagaggatgggggaaagaataaggctcaggctgcatgaagaaaaaattattaaggaccgaagacacc acctgaagacttacccgaactgttttgttgccaaagaattgattgactggctgattgatcacaaagaggcctttgacagg gagacagcaattaaacttgtgcagaagctactggatcgtagcattatccatcatgtttgtgatgagcataaggaattcaa ggatctcaaacttttctaccgctttaggaaagacgatgggacattcccacttgacaacgaagtgaaggctttcatgagag gacagagaatatacgaaaaaaaggaagtttatagtgatgccaatgaagaaaaaaggcttatgaatactgagaatgtaatt ttacaagccagagaagaagaaggagcaaaatatgagcgtactttcatggcctctcaactgattgactggttgatccagga aggggaggctgccacgagagcggaggctgaacaactcggtcgcagacttctggagcatggaattatccaacacgtgtcca acaaacaccattttatggatagcaacctgctctatcagttccggatgaatttccgccgcaggagaagactgatggaacta cttaccgagaagtctcacttggtgcccgagagccatgatagtcccttttgcctgcggaagcaaaatcatgaccacaaaaa acatgccactttcctctcag |
|
Protein
| Protein ID | habu1_s24_g00212.t1 |
|---|---|
| Definition | - |
>habu1_s24_g00212.t1 MISGFQIQIDSRYLDQSKRMGERIRLRLHEEKIIKDRRHHLKTYPNCFVAKELIDWLIDHKEAFDRETAIKLVQKLLDRS IIHHVCDEHKEFKDLKLFYRFRKDDGTFPLDNEVKAFMRGQRIYEKKEVYSDANEEKRLMNTENVILQAREEEGAKYERT FMASQLIDWLIQEGEAATRAEAEQLGRRLLEHGIIQHVSNKHHFMDSNLLYQFRMNFRRRRRLMELLTEKSHLVPESHDS PFCLRKQNHDHKKHATFLS |
|