Gene
| Gene Model ID | habu1_s2598_g09395 |
|---|---|
| Locus | habu1_scaffold2598 : 1441610 ... 1500574 : - |
| To GenomeBrowser | habu1_scaffold2598:1441610..1500574 |
| Genes list of scaffold | habu1_scaffold2598 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s2598_g09395.t1 | 1 | 1 | RVT_1 | 43 | 97 | 1.3e-08 | 34.5 | 9.8e-13 | 1.5e-08 | 34.3 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.0 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 0.0 |
| Nose | 0.0 |
| Brain-1 | 0.0 |
| Eye | 0.0 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.0 |
| Brain-2 | 0.0 |
| Spleen | 0.0 |
| Lung | 0.0 |
| Liver | 0.0 |
| Kidney | 0.0 |
| Pancreas | 0.0 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 0.0 |
Transcript
| Transcript ID | habu1_s2598_g09395.t1 |
|---|---|
| Definition | - |
>habu1_s2598_g09395.t1 aggactttccctgcccgggagcgccgcgcatgcgtggttccgcccccctgcgccggtcgaggcgtagctggcaagtggca gagacagagcaggccgaccaccagctggcccagcccaagggagcttttgccatcacaggtgttgttgaaatggcccaggt tgtgcgagttgaaaagaaagtttccaactccatctccttgagtatagattctccacagggctgtgtcctgagtccgctac tgttcaccttgatgacccacgattgctgtgccaaatctgctacgaatcatattgtgaagtatgcagatgacacggcagtg gtgaatcttatacaggatgacaatgaagatgcttaaagggaagaggtgaaggctctgatggactggtgcaataaaagtaa cctggttctaaatgttg |
|
Protein
| Protein ID | habu1_s2598_g09395.t1 |
|---|---|
| Definition | - |
>habu1_s2598_g09395.t1 MRGSAPLRRSRRSWQVAETEQADHQLAQPKGAFAITGVVEMAQVVRVEKKVSNSISLSIDSPQGCVLSPLLFTLMTHDCC AKSATNHIVKYADDTAVVNLIQDDNEDA |
|