Gene
| Gene Model ID | habu1_s2789_g10011 |
|---|---|
| Locus | habu1_scaffold2789 : 846899 ... 848122 : + |
| To GenomeBrowser | habu1_scaffold2789:846899..848122 |
| Genes list of scaffold | habu1_scaffold2789 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| mitochondrial import inner membrane translocase subunit tim16-like | GO:0005744 GO:0030150 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s2789_g10011.t1 | 1 | 1 | Pam16 | 1 | 119 | 0.0 | 176.7 | 0.0 | 0.0 | 176.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2789_g10011.t1 | gi|345309200|ref|XP_001514830.2| | PREDICTED: mitochondrial import inner membrane translocase subunit TIM16 [Ornithorhynchus anatinus] | 0.0 |
| habu1_s2789_g10011.t1 | gi|545183699|ref|XP_005599062.1| | PREDICTED: mitochondrial import inner membrane translocase subunit TIM16 [Equus caballus] | 0.0 |
| habu1_s2789_g10011.t1 | gi|532104396|ref|XP_005337791.1| | PREDICTED: mitochondrial import inner membrane translocase subunit TIM16 isoform X1 [Ictidomys tridecemlineatus] | 0.0 |
| habu1_s2789_g10011.t1 | gi|548434220|ref|XP_005744422.1| | PREDICTED: mitochondrial import inner membrane translocase subunit TIM16-like isoform X4 [Pundamilia nyererei] | 0.0 |
| habu1_s2789_g10011.t1 | gi|655889186|ref|XP_008247819.1| | PREDICTED: mitochondrial import inner membrane translocase subunit TIM16 isoform X2 [Oryctolagus cuniculus] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 24.7 |
| Venom grand-1 | 109.3 |
| Pit, infrared sensing | 47.4 |
| Nose | 24.7 |
| Brain-1 | 13.0 |
| Eye | 38.7 |
| fetal fibroblast | 32.0 |
| venom gland-2 | 104.2 |
| Brain-2 | 20.3 |
| Spleen | 86.8 |
| Lung | 77.0 |
| Liver | 550.4 |
| Kidney | 188.0 |
| Pancreas | 300.6 |
| Small intestine | 196.6 |
| Large intestine | 91.6 |
| Stomach | 223.8 |
| heart | 96.7 |
| ovary | 47.5 |
| cheek muscle | 192.6 |
Transcript
| Transcript ID | habu1_s2789_g10011.t1 |
|---|---|
| Definition | - |
>habu1_s2789_g10011.t1 ctttcggcgctcctcaatggctgcttccgggacgaagggccgctccttccggccgcactcgcctcggggcgttctgagct gagctcccgctgcggacatggccaagtacctggcgcagatcgtcctggtgggcgcccaggtgctgggccgcgccttcgcc cgcgcgctgcggcaggagttcgcagccagccaagcggccgccgagacacgcgggcggacgggcgcccagtcctgggccgc ctccagcctctccgggatcagcctgcaggaagctcagcagatcctcaacgtctccacgctcagtccggaggagatccaga agaactacgagcatttatttaaggtgaacgacaaatccgtgggaggctccttttatctgcagtccaaggtggtgagagcc aaggagcggctggacgaagagctgaggatccagtcccagagagaacaagacccgccacacaagccaggcacgtagcatag cctctctcttgcactggcgtcccctctaaattaaagctagccaataaattgccctcgtgtagctggtctc |
|
Protein
| Protein ID | habu1_s2789_g10011.t1 |
|---|---|
| Definition | - |
>habu1_s2789_g10011.t1 MAKYLAQIVLVGAQVLGRAFARALRQEFAASQAAAETRGRTGAQSWAASSLSGISLQEAQQILNVSTLSPEEIQKNYEHL FKVNDKSVGGSFYLQSKVVRAKERLDEELRIQSQREQDPPHKPGT |
|