Gene
| Gene Model ID | habu1_s2857_g10188 |
|---|---|
| Locus | habu1_scaffold2857 : 331115 ... 338825 : - |
| To GenomeBrowser | habu1_scaffold2857:331115..338825 |
| Genes list of scaffold | habu1_scaffold2857 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| receptor expression-enhancing protein 4 isoform x3 | GO:0005783 GO:0007084 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s2857_g10188.t1 | 1 | 1 | TB2_DP1_HVA22 | 7 | 95 | 2.0e-31 | 107.5 | 6.3e-35 | 3.1e-31 | 106.9 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s2857_g10188.t1 | gi|530582644|ref|XP_005285165.1| | PREDICTED: receptor expression-enhancing protein 4 isoform X3 [Chrysemys picta bellii] | 0.0 |
| habu1_s2857_g10188.t1 | gi|327287128|ref|XP_003228281.1| | PREDICTED: receptor expression-enhancing protein 4 [Anolis carolinensis] | 0.0 |
| habu1_s2857_g10188.t1 | gi|591383851|ref|XP_007066384.1| | PREDICTED: LOW QUALITY PROTEIN: receptor expression-enhancing protein 4 [Chelonia mydas] | 0.0 |
| habu1_s2857_g10188.t1 | gi|530582642|ref|XP_005285164.1| | PREDICTED: receptor expression-enhancing protein 4 isoform X2 [Chrysemys picta bellii] | 0.0 |
| habu1_s2857_g10188.t1 | gi|530582640|ref|XP_005285163.1| | PREDICTED: receptor expression-enhancing protein 4 isoform X1 [Chrysemys picta bellii] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 11.1 |
| Venom grand-1 | 16.2 |
| Pit, infrared sensing | 12.8 |
| Nose | 12.7 |
| Brain-1 | 9.6 |
| Eye | 11.3 |
| fetal fibroblast | 10.4 |
| venom gland-2 | 11.9 |
| Brain-2 | 9.9 |
| Spleen | 11.4 |
| Lung | 26.6 |
| Liver | 15.5 |
| Kidney | 10.9 |
| Pancreas | 12.7 |
| Small intestine | 12.0 |
| Large intestine | 13.5 |
| Stomach | 8.3 |
| heart | 15.8 |
| ovary | 28.1 |
| cheek muscle | 7.4 |
Transcript
| Transcript ID | habu1_s2857_g10188.t1 |
|---|---|
| Definition | - |
>habu1_s2857_g10188.t1 gggcggggataaaggcggccaatggcagcgcgcgcgggcggttggagcggcgatggtggcctgggcgctgagccgcgccg tgcagctcctgctggggacgctgtacccggcctacgcctcgtacaaggccgtgaggaacaaggacgtccgggagtacgtg cggtggatgatgtactggatcgtcttcgcgctcttcatggccacggagaccgtcacggacaccttcttttcctggtttcc cttctactatgagatcaaaatggcctttgtggtatggctcctgtctccttacacaaagggggccagcttattgtaccgca agtttgtgcatcctacactgtccagcaaagaaaaggagattgaccacttcatctgccaagccaaagagcgtggctatgag agtcttgtgagctttgggaagaagagcatcaatgtggcagccacagcagctatccagggccagggtgccctggcaggtcg tttacgcagcttcagtatgcaggatttgcgttccatcccagagacagccatggtgcattattcagatcccctctatctgg aggaacaggagctatgccggcaaccgattgggcgcaggccagcagcgcagcagccgggctccgatagcgaggaggaggag caggaggactgctggacagactctgaagtgtccgccccctccaggggccgctgcagggaccccgccctcccgaagccctt ggccagaagccaaagcttccggcaggtgaagaagcggccgccagctaaagagacttctcgggggctccgaactcgcggga cgctgaagagcctgcagcaggcggacgcggagtccctgcaggcgctgtggtgggaccgggagagccccgccctgccgctc cgctcgcgggacatcctgcccttaatggacctggcgctgcagtaccgcgccagcccccgccaccctcccgtcctgccgct ggagctgccctgcgcctcggtttgccagaggctcctgctcgtcttcaccggcagcgacgactccttatgggtgctgctgg aaaccaccggggcgccgcatctgcccgtggcgatcagcagcctgtctccctcgaagtcaggcaagaggctccgggcagcc gtccagccgctgctccagaaatgcacggcccggcctgaagcggccgtccacctccagggcttacttggcctgcagcacct tggcaaggatccggggcaaagcgacggcatctgcttcaacgtggtggccacagtcggaagcgacggcccgcagcagcagg agccggccccaccggcattgcaggagccggctttcacctggtgggaggtggaagacgcagctctgaagagccaggtgctc caaaggcttcgcaccgcttcttttctccccatttacagttagcttctcccagcccagggctgcgccagaaatggaagccc ccgagttctggctgggatagcaacgccccgaggccaccggacgcagagcaggtctgggatgcctcttttccaaatgatgc tattctacccacccctgctgaatgcaaggtgggcagggaagaccaagcagtcctggcagcctttggtacatttacagcta ttaatacatagctgaattaataaatacatttatttcattgtggctc |
|
Protein
| Protein ID | habu1_s2857_g10188.t1 |
|---|---|
| Definition | - |
>habu1_s2857_g10188.t1 MVAWALSRAVQLLLGTLYPAYASYKAVRNKDVREYVRWMMYWIVFALFMATETVTDTFFSWFPFYYEIKMAFVVWLLSPY TKGASLLYRKFVHPTLSSKEKEIDHFICQAKERGYESLVSFGKKSINVAATAAIQGQGALAGRLRSFSMQDLRSIPETAM VHYSDPLYLEEQELCRQPIGRRPAAQQPGSDSEEEEQEDCWTDSEVSAPSRGRCRDPALPKPLARSQSFRQVKKRPPAKE TSRGLRTRGTLKSLQQADAESLQALWWDRESPALPLRSRDILPLMDLALQYRASPRHPPVLPLELPCASVCQRLLLVFTG SDDSLWVLLETTGAPHLPVAISSLSPSKSGKRLRAAVQPLLQKCTARPEAAVHLQGLLGLQHLGKDPGQSDGICFNVVAT VGSDGPQQQEPAPPALQEPAFTWWEVEDAALKSQVLQRLRTASFLPIYS |
|