Gene
| Gene Model ID | habu1_s3258_g11210 |
|---|---|
| Locus | habu1_scaffold3258 : 1 ... 14651 : + |
| To GenomeBrowser | habu1_scaffold3258:1..14651 |
| Genes list of scaffold | habu1_scaffold3258 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| metalloprotease piia | EC:3.4.24.0 GO:0004222 GO:0005576 GO:0006508 GO:0008270 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s3258_g11210.t1 | 2 | 1 | Reprolysin | 68 | 104 | 8.2e-26 | 90.8 | 9.4e-10 | 1.5e-06 | 27.9 |
| habu1_s3258_g11210.t1 | 2 | 2 | Reprolysin | 101 | 178 | 8.2e-26 | 90.8 | 3.6e-23 | 5.9e-20 | 71.6 |
| habu1_s3258_g11210.t1 | 1 | 1 | Disintegrin | 195 | 266 | 1.5e-18 | 66.7 | 9.0e-22 | 1.5e-18 | 66.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s3258_g11210.t1 | gi|727055681|ref|XP_010406645.1| | PREDICTED: disintegrin and metalloproteinase domain-containing protein 28 [Corvus cornix cornix] | 0.0 |
| habu1_s3258_g11210.t1 | gi|449488183|ref|XP_002193440.2| | PREDICTED: zinc metalloproteinase-disintegrin-like ohanin [Taeniopygia guttata] | 0.0 |
| habu1_s3258_g11210.t1 | gi|675713686|ref|XP_008977359.1| | PREDICTED: disintegrin and metalloproteinase domain-containing protein 28 isoform X5 [Callithrix jacchus] | 0.0 |
| habu1_s3258_g11210.t1 | gi|426359136|ref|XP_004046841.1| | PREDICTED: disintegrin and metalloproteinase domain-containing protein 28, partial [Gorilla gorilla gorilla] | 9.80909e-45 |
| habu1_s3258_g11210.t1 | gi|583992324|ref|XP_006791337.1| | PREDICTED: disintegrin and metalloproteinase domain-containing protein 9-like [Neolamprologus brichardi] | 1.99965e-42 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.1 |
| Venom grand-1 | 89.9 |
| Pit, infrared sensing | 0.1 |
| Nose | 0.0 |
| Brain-1 | 0.0 |
| Eye | 0.0 |
| fetal fibroblast | 0.2 |
| venom gland-2 | 526.6 |
| Brain-2 | 0.0 |
| Spleen | 0.0 |
| Lung | 0.0 |
| Liver | 0.0 |
| Kidney | 0.0 |
| Pancreas | 0.1 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 1.0 |
Transcript
| Transcript ID | habu1_s3258_g11210.t1 |
|---|---|
| Definition | - |
>habu1_s3258_g11210.t1 aggacatttcaagcttcaaggggagacgtactttattgaacccttgaagctttccgacagtgaagcccatgcagtctaca aatatgaaaacgtagaaaaggaggacgaggcccccaaaatgtgtggggtaaccgagactaattgggaatcagatgagccc atcaaaaaggcctctcagttaaatcttactcctgatgaaaaaagattcattgagcttgtcatagttgcggaccacagaat gttcacgaaatatgaaggtgatgaaactgagatacgttcaagaatatatgaaagtgtcaacgctttaaatgtggatcata gaagtagatatcattttgttgcaaatagaatggcccatgagctgggtcataatctgggcattcatcatgacggagattcg tgttcttgcagtgctgactcatgcattatgtctgcaacagtaagcaacgaaccttccagttggttcagcgattgtagtct taatcaatattcgagtgatattattcatattcatcgttgccttttgaatgaaccctcgaagacagatattgtttcacctc cagtttgtggcaattactatgtggaggtgggagaagattgtgactgtggccttcctgcagattgtcagaatacatgctgt gatgctacaacctgtaaactgacaccaggggcacagtgtgcagaaggactgtgttgtgataagtgcagatttatagaagc aagaaaaatatgtcggaaaggaaggggtgataatccggatgatcgctgcactggccgatctggtgactgtcccagaaatg cctaaacaacaatggagatggaatggtctgcagcaacggggagtgtgttgatctgaatatagcctactaatcaacctttg act |
|
Protein
| Protein ID | habu1_s3258_g11210.t1 |
|---|---|
| Definition | - |
>habu1_s3258_g11210.t1 GHFKLQGETYFIEPLKLSDSEAHAVYKYENVEKEDEAPKMCGVTETNWESDEPIKKASQLNLTPDEKRFIELVIVADHRM FTKYEGDETEIRSRIYESVNALNVDHRSRYHFVANRMAHELGHNLGIHHDGDSCSCSADSCIMSATVSNEPSSWFSDCSL NQYSSDIIHIHRCLLNEPSKTDIVSPPVCGNYYVEVGEDCDCGLPADCQNTCCDATTCKLTPGAQCAEGLCCDKCRFIEA RKICRKGRGDNPDDRCTGRSGDCPRNA |
|