Gene
| Gene Model ID | habu1_s3274_g11228 |
|---|---|
| Locus | habu1_scaffold3274 : 23966 ... 30421 : + |
| To GenomeBrowser | habu1_scaffold3274:23966..30421 |
| Genes list of scaffold | habu1_scaffold3274 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| reactive oxygen species modulator 1 | GO:0044699 GO:0048522 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s3274_g11228.t1 | 1 | 1 | Romo1 | 13 | 79 | 2.7e-27 | 94.7 | 6.7e-31 | 3.3e-27 | 94.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s3274_g11228.t1 | gi|602668011|ref|XP_007439560.1| | PREDICTED: reactive oxygen species modulator 1 isoform X1 [Python bivittatus] | 0.0 |
| habu1_s3274_g11228.t1 | gi|327271499|ref|XP_003220525.1| | PREDICTED: reactive oxygen species modulator 1 [Anolis carolinensis] | 2.8026e-45 |
| habu1_s3274_g11228.t1 | gi|543378120|ref|XP_005532263.1| | PREDICTED: reactive oxygen species modulator 1 isoform X1 [Pseudopodoces humilis] | 4.2039e-45 |
| habu1_s3274_g11228.t1 | gi|311771755|ref|NP_001185746.1| | reactive oxygen species modulator 1 [Taeniopygia guttata] | 4.2039e-45 |
| habu1_s3274_g11228.t1 | gi|530648525|ref|XP_005310819.1| | PREDICTED: reactive oxygen species modulator 1 [Chrysemys picta bellii] | 5.60519e-45 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 116.3 |
| Venom grand-1 | 299.9 |
| Pit, infrared sensing | 126.3 |
| Nose | 126.8 |
| Brain-1 | 49.7 |
| Eye | 104.4 |
| fetal fibroblast | 209.5 |
| venom gland-2 | 287.0 |
| Brain-2 | 88.7 |
| Spleen | 95.6 |
| Lung | 89.3 |
| Liver | 224.1 |
| Kidney | 196.5 |
| Pancreas | 205.3 |
| Small intestine | 131.9 |
| Large intestine | 181.8 |
| Stomach | 204.4 |
| heart | 298.7 |
| ovary | 184.4 |
| cheek muscle | 625.5 |
Transcript
| Transcript ID | habu1_s3274_g11228.t1 |
|---|---|
| Definition | - |
>habu1_s3274_g11228.t1 cgtcgttggagagacttctcaggggtcgagatgcctgtgacagtgggatcatacggccagtcccagcccagttgttttga cagagtaaaaatgggctttatgatgggctttgctgttggcatggcagcaggtgcactgtttggcacgttttcttgtgtca ggattggcatgagaggacgagaactgatgggtggcgttggcaaaaccatgatgcagagtggtggaacatttgggactttt atggctattggcatgggaatccgctgttaacttgaatttcttttattcttttttaccatgaagactaatgcccccgttag tccagatcctgttatgtaaaataaaactttgtaccaggaataagata |
|
Protein
| Protein ID | habu1_s3274_g11228.t1 |
|---|---|
| Definition | - |
>habu1_s3274_g11228.t1 MPVTVGSYGQSQPSCFDRVKMGFMMGFAVGMAAGALFGTFSCVRIGMRGRELMGGVGKTMMQSGGTFGTFMAIGMGIRC |
|