Gene
| Gene Model ID | habu1_s3443_g11708 |
|---|---|
| Locus | habu1_scaffold3443 : 152261 ... 154635 : - |
| To GenomeBrowser | habu1_scaffold3443:152261..154635 |
| Genes list of scaffold | habu1_scaffold3443 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| neuropeptide b | GO:0001664 GO:0007218 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s3443_g11708.t1 | 1 | 1 | NPBW | 7 | 130 | 1.4013e-45 | 153.6 | 0.0 | 1.4013e-45 | 153.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s3443_g11708.t1 | gi|327265146|ref|XP_003217369.1| | PREDICTED: neuropeptide B [Anolis carolinensis] | 0.0 |
| habu1_s3443_g11708.t1 | gi|602642102|ref|XP_007427844.1| | PREDICTED: neuropeptide B [Python bivittatus] | 2.0e-40 |
| habu1_s3443_g11708.t1 | gi|573894919|ref|XP_006635208.1| | PREDICTED: neuropeptide B-like [Lepisosteus oculatus] | 2.0e-37 |
| habu1_s3443_g11708.t1 | gi|736202046|ref|XP_010774760.1| | PREDICTED: neuropeptide B [Notothenia coriiceps] | 7.0e-37 |
| habu1_s3443_g11708.t1 | gi|734629943|ref|XP_010743289.1| | PREDICTED: neuropeptide B [Larimichthys crocea] | 4.0e-36 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 4.5 |
| Venom grand-1 | 4.0 |
| Pit, infrared sensing | 6.2 |
| Nose | 2.7 |
| Brain-1 | 2.3 |
| Eye | 3.3 |
| fetal fibroblast | 5.7 |
| venom gland-2 | 3.3 |
| Brain-2 | 5.1 |
| Spleen | 5.3 |
| Lung | 6.6 |
| Liver | 3.5 |
| Kidney | 4.2 |
| Pancreas | 3.4 |
| Small intestine | 1.6 |
| Large intestine | 6.6 |
| Stomach | 7.2 |
| heart | 9.6 |
| ovary | 4.2 |
| cheek muscle | 10.7 |
Transcript
| Transcript ID | habu1_s3443_g11708.t1 |
|---|---|
| Definition | - |
>habu1_s3443_g11708.t1 ggagccgcctgggtgctccccgttcctgtcctgcctccccggtgctataaaaggaggcgccgatggcgaccaccaaccca gccgtcgccagcctctcgcagcatgggcggaccacccaccctggcgctgctcagcctcaccctggccctgctgctcagcc cgcccgccgaggcgtggtacaagcaggcggccggccccagctactactccgtgggcagagcgtcggggcttctctctggc atccgccgctcgccttacgtgcgccgctccgacgacaacagcgtcgcggacagtagcgccgaggacggccccgccgcatc ctctctcgcgatgtccgagtcgcggctgaacctcggcgggctgcgcaacatggcagtatgtgtgaaggaagtggctccag aactgcaaagctgccagctactgcctggtatgcccagcaccattcagtgcaaggcggatgtcaccgtctctttggacccc actgactgtactatcccataagccttgagcaggtggccttccctgtaacttctatggaggcactgggaggtgggacaagc tggcaagagatggatttactctctgtgtgaaaggtggttggatttgggggtggtgaggaatatggttttatttttatttt ttctgcatctgttaataaatgtgttttaaaaggctccagtg |
|
Protein
| Protein ID | habu1_s3443_g11708.t1 |
|---|---|
| Definition | - |
>habu1_s3443_g11708.t1 MGGPPTLALLSLTLALLLSPPAEAWYKQAAGPSYYSVGRASGLLSGIRRSPYVRRSDDNSVADSSAEDGPAASSLAMSES RLNLGGLRNMAVCVKEVAPELQSCQLLPGMPSTIQCKADVTVSLDPTDCTIP |
|