Gene
| Gene Model ID | habu1_s3443_g11725 |
|---|---|
| Locus | habu1_scaffold3443 : 578540 ... 580029 : - |
| To GenomeBrowser | habu1_scaffold3443:578540..580029 |
| Genes list of scaffold | habu1_scaffold3443 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| suppressor of cytokine signaling 3 | GO:0001932 GO:0007259 GO:0016567 GO:0043066 GO:0045597 GO:0046627 GO:0050728 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s3443_g11725.t1 | 1 | 1 | SH2 | 46 | 127 | 8.3e-10 | 38.3 | 3.3e-13 | 1.6e-09 | 37.3 |
| habu1_s3443_g11725.t1 | 1 | 1 | SOCS_box | 166 | 201 | 3.6e-09 | 36.3 | 1.4e-12 | 7.0e-09 | 35.3 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s3443_g11725.t1 | gi|602644222|ref|XP_007428564.1| | PREDICTED: suppressor of cytokine signaling 3 [Python bivittatus] | 0.0 |
| habu1_s3443_g11725.t1 | gi|637266413|ref|XP_008102404.1| | PREDICTED: suppressor of cytokine signaling 3 [Anolis carolinensis] | 0.0 |
| habu1_s3443_g11725.t1 | gi|525017532|ref|XP_005056317.1| | PREDICTED: suppressor of cytokine signaling 3 [Ficedula albicollis] | 0.0 |
| habu1_s3443_g11725.t1 | gi|694856864|ref|XP_009470043.1| | PREDICTED: suppressor of cytokine signaling 3 [Nipponia nippon] | 0.0 |
| habu1_s3443_g11725.t1 | gi|542178744|ref|XP_005495704.1| | PREDICTED: suppressor of cytokine signaling 3 [Zonotrichia albicollis] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 6.5 |
| Venom grand-1 | 1.1 |
| Pit, infrared sensing | 26.1 |
| Nose | 15.6 |
| Brain-1 | 1.6 |
| Eye | 3.7 |
| fetal fibroblast | 15.4 |
| venom gland-2 | 0.5 |
| Brain-2 | 1.0 |
| Spleen | 1.1 |
| Lung | 2.7 |
| Liver | 0.1 |
| Kidney | 0.3 |
| Pancreas | 0.4 |
| Small intestine | 0.6 |
| Large intestine | 3.1 |
| Stomach | 0.7 |
| heart | 3.6 |
| ovary | 0.2 |
| cheek muscle | 1.3 |
Transcript
| Transcript ID | habu1_s3443_g11725.t1 |
|---|---|
| Definition | - |
>habu1_s3443_g11725.t1 aaagtaggacaagctaagcgcgctgaagcggaccgctcttcgttccgtctcgccagcagccgcgctctgccagcagcttg gattgacccccgcgattcttttctcggcccccccccccaggtacccatcctagcagccgctgcgcttggcagcagcccag attacttgcaaagctggctccctgcgccatggtcacccacagcaagttccccagtgccgggatgagccacccgctggaca ccagcctgcgcctcaagacgttcagttccaagagcgaatatcagctggtggtgaatgctgtgcgcaagctgcaggagagt ggcttctactggagcacggtgacaggcggtcaggccaacctgctcctgagcgctgaacccatcggcaccttcctcatccg tgacagctcagaccagcgccacttcttcactctgagcgtcaagactgagtcaggcaccaaaaacttgcggatccagtgtg aaggaggtagcttctcactccagagtgatccgcacagcagccagcctgtgccccgctttgactgtgttctcaaacttgtt catcactacatgcccctccctgagcaacaaccagggcaggcatcacaccctaaacgtgcctactatatctactcaggtgg agagaagatcccgctggtgctgagccgccccctctcctccagtgtctccaccctgcaacatttgtgtcgcaagactgtca atgggcacttggattcctatgagaagaggacccaacttcccgctcccatcaaagacttcttggaccagtatgatgcgcct ttctaaggggctttttcagcaggattagcccgtgacataagcacaagagcagaacgaggaaaggatgaagatgggagaat ccaggacaaaactcacccttttttccccctagcatgtggattatgaaaggggcagaggggcccagcacacagaatagcct agaaacctctgcccagcacagaaactgtcttgctgttgcttatgctggataacttgccaaagggggatttgtgcaagtga ctgatgctgttggactattgaacaggctgttgctccttaataaaactgtctctctggcttaggatg |
|
Protein
| Protein ID | habu1_s3443_g11725.t1 |
|---|---|
| Definition | - |
>habu1_s3443_g11725.t1 MVTHSKFPSAGMSHPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSTVTGGQANLLLSAEPIGTFLIRDSSDQRHFF TLSVKTESGTKNLRIQCEGGSFSLQSDPHSSQPVPRFDCVLKLVHHYMPLPEQQPGQASHPKRAYYIYSGGEKIPLVLSR PLSSSVSTLQHLCRKTVNGHLDSYEKRTQLPAPIKDFLDQYDAPF |
|