Gene
| Gene Model ID | habu1_s399842_g24547 |
|---|---|
| Locus | habu1_scaffold399842 : 149434 ... 154755 : - |
| To GenomeBrowser | habu1_scaffold399842:149434..154755 |
| Genes list of scaffold | habu1_scaffold399842 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| morn repeat-containing protein 3 | GO:0005634 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s399842_g24547.t1 | 5 | 1 | MORN | 38 | 56 | 8.7e-28 | 94.3 | 1.2e-08 | 0.00018 | 21.0 |
| habu1_s399842_g24547.t1 | 5 | 2 | MORN | 62 | 81 | 8.7e-28 | 94.3 | 6.2e-09 | 9.2e-05 | 21.9 |
| habu1_s399842_g24547.t1 | 5 | 3 | MORN | 114 | 134 | 8.7e-28 | 94.3 | 2.3e-07 | 0.0034 | 17.0 |
| habu1_s399842_g24547.t1 | 5 | 4 | MORN | 137 | 159 | 8.7e-28 | 94.3 | 1.3e-08 | 0.0002 | 20.9 |
| habu1_s399842_g24547.t1 | 5 | 5 | MORN | 160 | 177 | 8.7e-28 | 94.3 | 2.4e-10 | 3.5e-06 | 26.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s399842_g24547.t1 | gi|602631840|ref|XP_007422817.1| | PREDICTED: MORN repeat-containing protein 3 [Python bivittatus] | 0.0 |
| habu1_s399842_g24547.t1 | gi|591367008|ref|XP_007058356.1| | PREDICTED: MORN repeat-containing protein 3 [Chelonia mydas] | 0.0 |
| habu1_s399842_g24547.t1 | gi|530617941|ref|XP_005298696.1| | PREDICTED: MORN repeat-containing protein 3 [Chrysemys picta bellii] | 0.0 |
| habu1_s399842_g24547.t1 | gi|723541139|ref|XP_010310836.1| | PREDICTED: MORN repeat-containing protein 3 [Balearica regulorum gibbericeps] | 0.0 |
| habu1_s399842_g24547.t1 | gi|558221539|ref|XP_006136043.1| | PREDICTED: MORN repeat-containing protein 3 [Pelodiscus sinensis] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 2.5 |
| Venom grand-1 | 5.7 |
| Pit, infrared sensing | 3.3 |
| Nose | 6.3 |
| Brain-1 | 1.2 |
| Eye | 1.0 |
| fetal fibroblast | 0.8 |
| venom gland-2 | 2.2 |
| Brain-2 | 1.8 |
| Spleen | 1.9 |
| Lung | 3.3 |
| Liver | 1.1 |
| Kidney | 1.9 |
| Pancreas | 3.1 |
| Small intestine | 0.6 |
| Large intestine | 1.0 |
| Stomach | 0.8 |
| heart | 9.5 |
| ovary | 2.4 |
| cheek muscle | 3.4 |
Transcript
| Transcript ID | habu1_s399842_g24547.t1 |
|---|---|
| Definition | - |
>habu1_s399842_g24547.t1 ctcggagatttccactcttttgcttgcagctcaatcgcccaggtagaatctctgctccggatcacccaggagcccctgtg gcccttgggaaggtgtcattcgccagaaagacctctggggggcaggaaactttcagaattggccgtattgcggctctgcc gtgttgctatggccacttcccttgcccgcgcgggcttctgtgcctgggctgagcgcagatgaccacccaggattggccct gcggtcccccgggggcagagccgctctgtgccctcgattggagccccctgagcttacaatggcaggtacaagacgagatg cccatcatcaaatacccccgaagagtggaccccctttggcacgaatgggacaggaaggcgcaaaagtgcgggctgaggca cacggtttacgctgtcaacggagaccgctacgtcggggaatggctggacaacatcaaacacggcaaaggaacacaaatat ggaaaaaatccggagcgatctacagcggagactggaaattcggaaaacgggacggcttcgggacttacagtattccggac cctgtgacaaaagattataagaaagtatattccggctggtggaagaatgacaaaatgtggggctacggagttaagttcta ctccgagggagagtattacgagggcgaatgggcctgggggaagcgaaacggctgggggcggatgtactacaaagacgggg ccatctacgaaggccagtggtccgaagacaagcccggtggtcaagggatgtttcgctgtaaaaatgaaaaccgctacgaa ggttcctggaaagacggaaagaaacacggtccgggaaagtttatctatctagacaccggccagctctacgaagggtactg ggtggcagacataccgaagtgtggcaccatggttgattttggcagggatgaagctcccgtgcccacccaataccccatcc ccaagattgaactggcggatccagacggagtcttagaagaagctgttctgatattacagaacgccgaaatattcaattct cagccccagaaagaacgaggatgactataattctgcagacatttctctggtcaaggctgctttttaacagaaaggtctct ctgatggatgccattccttggaatatattatcctggctgtcttttgggc |
|
Protein
| Protein ID | habu1_s399842_g24547.t1 |
|---|---|
| Definition | - |
>habu1_s399842_g24547.t1 MPIIKYPRRVDPLWHEWDRKAQKCGLRHTVYAVNGDRYVGEWLDNIKHGKGTQIWKKSGAIYSGDWKFGKRDGFGTYSIP DPVTKDYKKVYSGWWKNDKMWGYGVKFYSEGEYYEGEWAWGKRNGWGRMYYKDGAIYEGQWSEDKPGGQGMFRCKNENRY EGSWKDGKKHGPGKFIYLDTGQLYEGYWVADIPKCGTMVDFGRDEAPVPTQYPIPKIELADPDGVLEEAVLILQNAEIFN SQPQKERG |
|