Gene
| Gene Model ID | habu1_s499_g02297 |
|---|---|
| Locus | habu1_scaffold499 : 131349 ... 141935 : - |
| To GenomeBrowser | habu1_scaffold499:131349..141935 |
| Genes list of scaffold | habu1_scaffold499 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| cox assembly mitochondrial protein 2 homolog isoform x2 | GO:0005739 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s499_g02297.t1 | 1 | 1 | Cmc1 | 1 | 70 | 5.2e-19 | 67.7 | 3.5e-22 | 5.7e-19 | 67.6 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s499_g02297.t1 | gi|602631411|ref|XP_007422607.1| | PREDICTED: COX assembly mitochondrial protein 2 homolog isoform X1 [Python bivittatus] | 4.00001e-40 |
| habu1_s499_g02297.t1 | gi|697505938|ref|XP_009681229.1| | PREDICTED: COX assembly mitochondrial protein 2 homolog [Struthio camelus australis] | 2.0e-33 |
| habu1_s499_g02297.t1 | gi|558160530|ref|XP_006122739.1| | PREDICTED: COX assembly mitochondrial protein 2 homolog isoform X2 [Pelodiscus sinensis] | 7.0e-32 |
| habu1_s499_g02297.t1 | gi|591368972|ref|XP_007059321.1| | PREDICTED: COX assembly mitochondrial protein 2 homolog isoform X2 [Chelonia mydas] | 1.0e-31 |
| habu1_s499_g02297.t1 | gi|530597711|ref|XP_005292381.1| | PREDICTED: COX assembly mitochondrial protein 2 homolog isoform X4 [Chrysemys picta bellii] | 5.0e-31 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 5.9 |
| Venom grand-1 | 13.3 |
| Pit, infrared sensing | 6.1 |
| Nose | 5.0 |
| Brain-1 | 9.2 |
| Eye | 8.6 |
| fetal fibroblast | 11.2 |
| venom gland-2 | 13.1 |
| Brain-2 | 5.6 |
| Spleen | 2.6 |
| Lung | 3.5 |
| Liver | 11.4 |
| Kidney | 7.5 |
| Pancreas | 7.4 |
| Small intestine | 4.6 |
| Large intestine | 4.8 |
| Stomach | 6.9 |
| heart | 14.9 |
| ovary | 12.3 |
| cheek muscle | 25.8 |
Transcript
| Transcript ID | habu1_s499_g02297.t1 |
|---|---|
| Definition | - |
>habu1_s499_g02297.t1 gcggggggagtagaaacctcggcctgtgactcactagactccgggaataacttccggatggagagacgttcgcttccggg ttatgcacttcctgggaggaagaccctatgttttttttttttccctttgggatgagtggttcctaactcgtgatgcatcc gaacttgtcacctcatctacacactgaagagtgtaacgttatcatccgtcaacttcaaaagtgccacaaggagcattccc tcttgaagttttttggccattgcaatgatattgacagagcaatgaggaaatgcctaaagaaagagtatgaagacaaccgt gccaagagccatgaacatgcaaaggagatgcagcggaggctgagggaggcttgaccagaagcagatacacttcccctggc taccttgcccttttttctttccctaaaatgaattaaagatgatacaaaatgcaagtcga |
|
Protein
| Protein ID | habu1_s499_g02297.t1 |
|---|---|
| Definition | - |
>habu1_s499_g02297.t1 MHPNLSPHLHTEECNVIIRQLQKCHKEHSLLKFFGHCNDIDRAMRKCLKKEYEDNRAKSHEHAKEMQRRLREA |
|