Gene
| Gene Model ID | habu1_s499_g02299 |
|---|---|
| Locus | habu1_scaffold499 : 153862 ... 154325 : - |
| To GenomeBrowser | habu1_scaffold499:153862..154325 |
| Genes list of scaffold | habu1_scaffold499 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.9 |
| Venom grand-1 | 0.6 |
| Pit, infrared sensing | 0.3 |
| Nose | 0.2 |
| Brain-1 | 0.7 |
| Eye | 1.1 |
| fetal fibroblast | 1.3 |
| venom gland-2 | 0.3 |
| Brain-2 | 2.5 |
| Spleen | 0.7 |
| Lung | 0.4 |
| Liver | 0.0 |
| Kidney | 0.1 |
| Pancreas | 0.0 |
| Small intestine | 0.2 |
| Large intestine | 1.3 |
| Stomach | 0.4 |
| heart | 1.2 |
| ovary | 13.3 |
| cheek muscle | 0.9 |
Transcript
| Transcript ID | habu1_s499_g02299.t1 |
|---|---|
| Definition | - |
>habu1_s499_g02299.t1 gacccaggccggggcccccgcgctgaggcggccactgcggctgaagagcctcaggaggaggaggaggaggaggagcggcc gccgccatgttcctcgcgcccgttcccaaaccaaccggtcgggcgcttccggtggggcagctcatgaatattgagagagg cgccgatttccatattcatgaggggcgcgtgggaaggagcggcgccggccccgccctcggagcggagatcccgccccttt tcggcggcttgaagtcacgtggggcgaggctgcgggccgaattccaggcggcggttcattcatcctatccattagtgccg gtttagtgaggccgcccgtttaccgagcgcgactttttggctttttaattttgcggatttctgggctgaatgcacagagt gagcttaaatgctccttcctaatgttggcatgaaacattaaagcaggggtctgcaaccttgacc |
|
Protein
| Protein ID | habu1_s499_g02299.t1 |
|---|---|
| Definition | - |
>habu1_s499_g02299.t1 MFLAPVPKPTGRALPVGQLMNIERGADFHIHEGRVGRSGAGPALGAEIPPLFGGLKSRGARLRAEFQAAVHSSYPLVPV |
|