Gene
| Gene Model ID | habu1_s536_g02465 |
|---|---|
| Locus | habu1_scaffold536 : 174046 ... 184825 : + |
| To GenomeBrowser | habu1_scaffold536:174046..184825 |
| Genes list of scaffold | habu1_scaffold536 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| ras-related protein rab-39a | GO:0005525 GO:0007264 GO:0015031 GO:0045335 GO:0090383 GO:0090385 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s536_g02465.t1 | 1 | 1 | Arf | 9 | 84 | 6.3e-09 | 35.3 | 2.8e-12 | 8.3e-09 | 34.9 |
| habu1_s536_g02465.t1 | 1 | 1 | Ras | 11 | 85 | 2.9e-25 | 88.5 | 1.3e-28 | 3.8e-25 | 88.1 |
| habu1_s536_g02465.t1 | 1 | 1 | Miro | 11 | 76 | 7.2e-07 | 29.7 | 3.0e-10 | 8.8e-07 | 29.4 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s536_g02465.t1 | gi|602669625|ref|XP_007440347.1| | PREDICTED: ras-related protein Rab-39A-like [Python bivittatus] | 0.0 |
| habu1_s536_g02465.t1 | gi|530592805|ref|XP_005290021.1| | PREDICTED: ras-related protein Rab-39A [Chrysemys picta bellii] | 0.0 |
| habu1_s536_g02465.t1 | gi|696968441|ref|XP_009554743.1| | PREDICTED: ras-related protein Rab-39A [Cuculus canorus] | 0.0 |
| habu1_s536_g02465.t1 | gi|524980330|ref|XP_005038212.1| | PREDICTED: ras-related protein Rab-39A [Ficedula albicollis] | 0.0 |
| habu1_s536_g02465.t1 | gi|729748735|ref|XP_010570889.1| | PREDICTED: ras-related protein Rab-39A [Haliaeetus leucocephalus] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.0 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 0.0 |
| Nose | 2.2 |
| Brain-1 | 3.0 |
| Eye | 0.1 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.6 |
| Brain-2 | 2.8 |
| Spleen | 0.0 |
| Lung | 0.1 |
| Liver | 0.0 |
| Kidney | 0.0 |
| Pancreas | 0.0 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 0.0 |
Transcript
| Transcript ID | habu1_s536_g02465.t1 |
|---|---|
| Definition | - |
>habu1_s536_g02465.t1 caccgcccgagaaggcgccccaaccaggccaaggggagcggccaccaggcggagggcagcggggagaccgccatggacgc ggccatctggatctaccagttccgcctgatcgtgctgggcgattccacggtgggcaagtcctgcctcttacatcgcttca ccgaaggccgtttcccgggcccgatgcactgcgatcccaccgtcggggtggatttcttctcccgcctggtggagatcgag ccgggcaagaggatcaagctgcagctctgggacacggcgggccaggagaggttcaggtcaatcacccgttcctattaccg gaattcagtctacgaaagaagtactgttaaaaacaaaacatttttcttaactgtctgtgatattcagttataatccattc ggcttaggtagaaaattgattttccatttaacagtgatgccaataaaacataaatcaaatatataaacc |
|
Protein
| Protein ID | habu1_s536_g02465.t1 |
|---|---|
| Definition | - |
>habu1_s536_g02465.t1 MDAAIWIYQFRLIVLGDSTVGKSCLLHRFTEGRFPGPMHCDPTVGVDFFSRLVEIEPGKRIKLQLWDTAGQERFRSITRS YYRNSVYERSTVKNKTFFLTVCDIQL |
|