Gene
Gene Model ID | habu1_s5890_g16364 |
---|---|
Locus | habu1_scaffold5890 : 355686 ... 359644 : + |
To GenomeBrowser | habu1_scaffold5890:355686..359644 |
Genes list of scaffold | habu1_scaffold5890 |
Expression profile
Libraries | FPKM |
---|---|
>Adult | |
Venom fang forming tissue | 0.0 |
Venom grand-1 | 0.0 |
Pit, infrared sensing | 0.0 |
Nose | 0.0 |
Brain-1 | 0.0 |
Eye | 0.0 |
fetal fibroblast | 0.0 |
venom gland-2 | 2.1 |
Brain-2 | 0.0 |
Spleen | 0.0 |
Lung | 0.0 |
Liver | 0.0 |
Kidney | 1.0 |
Pancreas | 0.0 |
Small intestine | 0.0 |
Large intestine | 0.0 |
Stomach | 0.0 |
heart | 0.0 |
ovary | 0.0 |
cheek muscle | 0.0 |
Transcript
Transcript ID | habu1_s5890_g16364.t1 |
---|---|
Definition | - |
>habu1_s5890_g16364.t1 tcgaggactaaaccggtcgagcgccgcgcatgcgtggttccgccccctgcgccggccgaggcgtagctggcannnnnnnn nnnnnnnnnnnnaatggggtcccgacccacaggttgagaaccactgaactagagggaatagccaacaccccagaagatag gctcaagattcagaaggatctcaacagattgaatactgggccttatctaaaaaatgaaattcagttgtgaaaaaaaggta aaattttgttataattttaataaatagtttttaggcccattgggtt |
Protein
Protein ID | habu1_s5890_g16364.t1 |
---|---|
Definition | - |
>habu1_s5890_g16364.t1 MRGSAPCAGRGVAGXXXXXXXNGVPTHRLRTTELEGIANTPEDRLKIQKDLNRLNTGPYLKNEIQL |