Gene
| Gene Model ID | habu1_s5910_g16407 |
|---|---|
| Locus | habu1_scaffold5910 : 195831 ... 200785 : - |
| To GenomeBrowser | habu1_scaffold5910:195831..200785 |
| Genes list of scaffold | habu1_scaffold5910 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s5910_g16407.t1 | gi|602629082|ref|XP_007421471.1| | PREDICTED: ubiquitin-like protein 5 isoform X1 [Python bivittatus] | 1.4013e-45 |
| habu1_s5910_g16407.t1 | gi|593715849|ref|XP_007104382.1| | PREDICTED: ubiquitin-like protein 5 isoform X1 [Physeter catodon] | 7.00649e-44 |
| habu1_s5910_g16407.t1 | gi|327277012|ref|XP_003223260.1| | PREDICTED: ubiquitin-like protein 5 [Anolis carolinensis] | 2.00386e-43 |
| habu1_s5910_g16407.t1 | gi|663250134|ref|XP_008488507.1| | PREDICTED: ubiquitin-like protein 5 [Calypte anna] | 5.99756e-43 |
| habu1_s5910_g16407.t1 | gi|557281095|ref|XP_006023518.1| | PREDICTED: ubiquitin-like protein 5 [Alligator sinensis] | 7.00649e-43 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 97.8 |
| Venom grand-1 | 147.1 |
| Pit, infrared sensing | 101.7 |
| Nose | 107.5 |
| Brain-1 | 99.4 |
| Eye | 107.9 |
| fetal fibroblast | 242.2 |
| venom gland-2 | 205.6 |
| Brain-2 | 119.6 |
| Spleen | 112.6 |
| Lung | 112.0 |
| Liver | 244.7 |
| Kidney | 193.2 |
| Pancreas | 184.7 |
| Small intestine | 106.7 |
| Large intestine | 123.5 |
| Stomach | 135.9 |
| heart | 230.6 |
| ovary | 137.2 |
| cheek muscle | 237.5 |
Transcript
| Transcript ID | habu1_s5910_g16407.t1 |
|---|---|
| Definition | - |
>habu1_s5910_g16407.t1 catcatttatcacagcgtttctttctaccgctttctagaagagccgaacgtgaagccgtgatcaagatgattgaagtagt ttgcaacgatcggctgggcaagaaagttagagtgaagtgcaacactgatgattgcatcagggatctgaagaagcttattg ctgcccaaactggtactcgctgggacaagatagttctaaagaaatggtatacaattttcaaggaccatgtgatgctggca gactatgaaatccatgatggtatgaacctggaactgtattatcagtagtgttttggtcatgacaaatactatcttttgct atgtttccttgttctgaatttctcagtgtatagatgggttactttgtggcttgacattaagtcgggaatattttatcctt gatggcaataaatcaggaagcctctgttcaaaccttgttttatgtatttgtattgaataaatgtgattgacacatatgct ctg |
|
Protein
| Protein ID | habu1_s5910_g16407.t1 |
|---|---|
| Definition | - |
>habu1_s5910_g16407.t1 MIEVVCNDRLGKKVRVKCNTDDCIRDLKKLIAAQTGTRWDKIVLKKWYTIFKDHVMLADYEIHDGMNLELYYQ |
|