Gene
| Gene Model ID | habu1_s5910_g16419 |
|---|---|
| Locus | habu1_scaffold5910 : 707779 ... 723605 : - |
| To GenomeBrowser | habu1_scaffold5910:707779..723605 |
| Genes list of scaffold | habu1_scaffold5910 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| nucleoredoxin-like protein 1 | GO:0005739 GO:0045494 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s5910_g16419.t1 | 1 | 1 | Thioredoxin_2 | 95 | 198 | 3.7e-07 | 30.3 | 4.6e-10 | 8.5e-07 | 29.1 |
| habu1_s5910_g16419.t1 | 1 | 1 | Thioredoxin_8 | 96 | 196 | 6.4e-24 | 83.9 | 7.9e-27 | 1.5e-23 | 82.7 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s5910_g16419.t1 | gi|602668868|ref|XP_007439974.1| | PREDICTED: nucleoredoxin-like protein 1 [Python bivittatus] | 0.0 |
| habu1_s5910_g16419.t1 | gi|327276998|ref|XP_003223253.1| | PREDICTED: nucleoredoxin-like protein 1 [Anolis carolinensis] | 0.0 |
| habu1_s5910_g16419.t1 | gi|530649913|ref|XP_005311437.1| | PREDICTED: nucleoredoxin-like protein 1 [Chrysemys picta bellii] | 0.0 |
| habu1_s5910_g16419.t1 | gi|591381181|ref|XP_007065128.1| | PREDICTED: nucleoredoxin-like protein 1 [Chelonia mydas] | 0.0 |
| habu1_s5910_g16419.t1 | gi|697438248|ref|XP_009688340.1| | PREDICTED: nucleoredoxin-like protein 1, partial [Struthio camelus australis] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.2 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 0.3 |
| Nose | 0.3 |
| Brain-1 | 0.1 |
| Eye | 8.8 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.0 |
| Brain-2 | 0.5 |
| Spleen | 0.1 |
| Lung | 0.0 |
| Liver | 0.1 |
| Kidney | 0.0 |
| Pancreas | 0.0 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 0.0 |
Transcript
| Transcript ID | habu1_s5910_g16419.t1 |
|---|---|
| Definition | - |
>habu1_s5910_g16419.t1 tcgtttgttacgaagttccgttttttctttccgccgtttccaactcccgtgttctcagatcgccgagttctgatgtgtct tctgcttctatcgaggttcgggttcccccccccagttacagaactgaatccaaaacatcaaaatagcacactgacaaatt ttattgcggctcacttcaccagatgcagtggaacggccagccgatacaggatttgaattggagtgaggcggaagggtgtg agagaaaggagaagacagttatgcggctacagaattcaagggattgcccattttttaccttaaagcaacattatgagata cagagaacaacgtctgcatcaggggtcaaaatttgcaagatggcaggtataacacacgatccaggtctcaccgttgccat tgaacacatatgcaaaggggacaatgatgagctggagttggaacgggagctcacccgaaaattagagaacaaagtcatgc tcctctattttggctccggtgaatgtcctcgatgccaagagtttgcgcccatcctgaaagatttttttgtgaaactcact gacgagttttatatggagcgagcgtctcaactagttctcgtctatgtgtcgctggacaaaacagaggaaaagcaagacaa gtttctgaagaaaatgccgaagcgatggctgtttttacctttccaggatgagttcaaaaaggagctggcattaagatttt cagtgactcatccccctgtagtggtagttttgaaaccaaatggtgaagtcattgaccacaatgctgtggaagaaatcaaa cagctaggcacagcttgcttcaagaactggcaagaagcagctgatttggtggacaggaacttccttttatctgaagactt cgaggatgtgaccctgagaagtatcactgatcccattcggcggttcaagtacaaactgcccaagaacaaaaggaaaatga gaagtagagatggtgataagggtgaagtctcctgatgagatgtttcttcttcttggaacttcaggaactcttgattaaag gagaaccttcccactttctttcagtcacccattggccatgctcaacttccaaataactctttctcctaagtgccaacatc ctttcttaaggacccaatgaagccagaattttaattctgtagtaccatcagcccatatagcaatgctatatttggatcaa tgaaaatctaactgttgtttttagagacttattgtacattttattttatctgaaaatagaaactgtccagaacaggatta ggcagaatttggattgaaggagtaacaatagaatagtattgtttgttaacaagcagaagtaaaaaaagaaaagtagataa tgttagttttgtgacctttggaataatgagcaagaattgttatttcaaggaaatttaataaatttaataaacacaagcaa tagaacataatga |
|
Protein
| Protein ID | habu1_s5910_g16419.t1 |
|---|---|
| Definition | - |
>habu1_s5910_g16419.t1 MQWNGQPIQDLNWSEAEGCERKEKTVMRLQNSRDCPFFTLKQHYEIQRTTSASGVKICKMAGITHDPGLTVAIEHICKGD NDELELERELTRKLENKVMLLYFGSGECPRCQEFAPILKDFFVKLTDEFYMERASQLVLVYVSLDKTEEKQDKFLKKMPK RWLFLPFQDEFKKELALRFSVTHPPVVVVLKPNGEVIDHNAVEEIKQLGTACFKNWQEAADLVDRNFLLSEDFEDVTLRS ITDPIRRFKYKLPKNKRKMRSRDGDKGEVS |
|