Gene
| Gene Model ID | habu1_s6078_g16662 |
|---|---|
| Locus | habu1_scaffold6078 : 123461 ... 128615 : - |
| To GenomeBrowser | habu1_scaffold6078:123461..128615 |
| Genes list of scaffold | habu1_scaffold6078 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| notch-regulated ankyrin repeat-containing protein | GO:0000122 GO:0001569 GO:0001938 GO:0002043 GO:0032525 GO:0045581 GO:0090263 GO:1902367 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s6078_g16662.t1 | 1 | 1 | Ank_2 | 20 | 107 | 1.2e-16 | 60.8 | 4.8e-20 | 1.4e-16 | 60.5 |
| habu1_s6078_g16662.t1 | 2 | 1 | Ank_5 | 43 | 91 | 4.3e-16 | 58.5 | 3.3e-15 | 9.8e-12 | 44.7 |
| habu1_s6078_g16662.t1 | 2 | 1 | Ank | 51 | 81 | 3.1e-15 | 55.1 | 6.0e-10 | 1.8e-06 | 27.4 |
| habu1_s6078_g16662.t1 | 1 | 1 | Ank_3 | 51 | 78 | 1.0e-12 | 46.9 | 1.7e-08 | 5.0e-05 | 23.1 |
| habu1_s6078_g16662.t1 | 1 | 1 | Ank_4 | 53 | 104 | 4.0e-14 | 52.6 | 3.8e-16 | 1.1e-12 | 48.0 |
| habu1_s6078_g16662.t1 | 2 | 2 | Ank | 83 | 105 | 3.1e-15 | 55.1 | 5.5e-09 | 1.6e-05 | 24.4 |
| habu1_s6078_g16662.t1 | 2 | 2 | Ank_5 | 87 | 109 | 4.3e-16 | 58.5 | 8.5e-07 | 0.0025 | 17.9 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s6078_g16662.t1 | gi|675640276|ref|XP_009004325.1| | PREDICTED: notch-regulated ankyrin repeat-containing protein [Callithrix jacchus] | 0.0 |
| habu1_s6078_g16662.t1 | gi|395506526|ref|XP_003757583.1| | PREDICTED: notch-regulated ankyrin repeat-containing protein [Sarcophilus harrisii] | 0.0 |
| habu1_s6078_g16662.t1 | gi|585713448|ref|XP_006900674.1| | PREDICTED: notch-regulated ankyrin repeat-containing protein [Elephantulus edwardii] | 0.0 |
| habu1_s6078_g16662.t1 | gi|505839542|ref|XP_004613297.1| | PREDICTED: notch-regulated ankyrin repeat-containing protein [Sorex araneus] | 0.0 |
| habu1_s6078_g16662.t1 | gi|743729621|ref|XP_010958908.1| | PREDICTED: notch-regulated ankyrin repeat-containing protein [Camelus bactrianus] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 1.7 |
| Venom grand-1 | 2.2 |
| Pit, infrared sensing | 1.1 |
| Nose | 1.1 |
| Brain-1 | 0.7 |
| Eye | 0.7 |
| fetal fibroblast | 0.6 |
| venom gland-2 | 0.3 |
| Brain-2 | 0.9 |
| Spleen | 1.6 |
| Lung | 0.7 |
| Liver | 0.0 |
| Kidney | 0.2 |
| Pancreas | 0.2 |
| Small intestine | 0.1 |
| Large intestine | 0.5 |
| Stomach | 0.4 |
| heart | 0.3 |
| ovary | 0.7 |
| cheek muscle | 0.0 |
Transcript
| Transcript ID | habu1_s6078_g16662.t1 |
|---|---|
| Definition | - |
>habu1_s6078_g16662.t1 gcggctcctgcgtgcccaggatgcccaggatcctgcaggaacctgaggacagcaactgcatgcaagaaggaggcagactt gacagtcagtcggttgcttctttgggacagagaaaacagccgggcgcgcagccatgagccaggcggagttgtcggccccc cgcgcggcgcccagccagcgcgtcttccaggaggcggtgcgcaagggcaacacggccgagctgcactcgctgctgcagaa catgagcagctgcgagttcaacgtgaactccttcggccccgagggccagacggcgctgcaccagtcggtgatcgacggca acctggagctggtcaagctgctggtcaagttcggcgcggacatccgcctggccaaccgcgacggctggagcgccctgcac atcgccgccttcgggggtcaccaggacatcgtcctctacctgatcaccaaggccaagaatggctccgaatccttgctcta aagtgagacctgcccagcttggtgggacttgcactgctgggctgacacaggagggaataaattagatactttctatgcaa ccc |
|
Protein
| Protein ID | habu1_s6078_g16662.t1 |
|---|---|
| Definition | - |
>habu1_s6078_g16662.t1 MSQAELSAPRAAPSQRVFQEAVRKGNTAELHSLLQNMSSCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLA NRDGWSALHIAAFGGHQDIVLYLITKAKNGSESLL |
|