Gene
| Gene Model ID | habu1_s6078_g16671 |
|---|---|
| Locus | habu1_scaffold6078 : 193146 ... 193895 : - |
| To GenomeBrowser | habu1_scaffold6078:193146..193895 |
| Genes list of scaffold | habu1_scaffold6078 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s6078_g16671.t1 | 2 | 1 | Tmemb_185A | 25 | 71 | 2.9e-10 | 40.1 | 3.7e-08 | 0.00054 | 19.6 |
| habu1_s6078_g16671.t1 | 2 | 2 | Tmemb_185A | 43 | 131 | 2.9e-10 | 40.1 | 7.9e-11 | 1.2e-06 | 28.3 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s6078_g16671.t1 | gi|696980359|ref|XP_009559000.1| | PREDICTED: transmembrane protein 203 [Cuculus canorus] | 0.0 |
| habu1_s6078_g16671.t1 | gi|525015651|ref|XP_005055403.1| | PREDICTED: transmembrane protein 203 [Ficedula albicollis] | 0.0 |
| habu1_s6078_g16671.t1 | gi|527247131|ref|XP_005141895.1| | PREDICTED: transmembrane protein 203 [Melopsittacus undulatus] | 0.0 |
| habu1_s6078_g16671.t1 | gi|543367696|ref|XP_005527198.1| | PREDICTED: transmembrane protein 203 [Pseudopodoces humilis] | 0.0 |
| habu1_s6078_g16671.t1 | gi|542166594|ref|XP_005491892.1| | PREDICTED: transmembrane protein 203 [Zonotrichia albicollis] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 23.6 |
| Venom grand-1 | 42.5 |
| Pit, infrared sensing | 27.0 |
| Nose | 20.9 |
| Brain-1 | 11.8 |
| Eye | 23.0 |
| fetal fibroblast | 19.7 |
| venom gland-2 | 62.3 |
| Brain-2 | 10.2 |
| Spleen | 24.8 |
| Lung | 17.2 |
| Liver | 78.3 |
| Kidney | 70.8 |
| Pancreas | 46.2 |
| Small intestine | 60.3 |
| Large intestine | 32.5 |
| Stomach | 39.2 |
| heart | 32.0 |
| ovary | 22.5 |
| cheek muscle | 52.3 |
Transcript
| Transcript ID | habu1_s6078_g16671.t1 |
|---|---|
| Definition | - |
>habu1_s6078_g16671.t1 cgtcggagcctctggcggtggcgcggcggccgcctccgctgcccgggcgcggcggggatgctgttctcgctgcgggagct ggtgcagtggctgggcttcgcgccgttcgagctgctcctgcaggcggcggcgctgctggcgacctcggggctgctggcgc tgaaggcggacggcgcggcggccgggctgagctggtggggcgtcttcgcgccgctcttcgccgccgacggtttgagcacc tacttcacggccatcgtgtcggtgcgcctcttccaggacggcgagaagcgcctggccgtgctgcgcctcttctggatcct gacgctcctcagcctcaagttcgtcttcgagatgctgctgtgccagaagctgggcgagcagagccacgagccgctctggt acgggctgatcatgtcgcccgtcttcatcctgcttcagctgcttatgatccgcgcctgccgagtcaattagcaggaggag gcgcttgcccggcagggccttggcaagaatgaccgtgcccctctggacagcagcaggctgaccgggactgtcctggaagg ctctctcgaccagctgtggctgctgacctgcttcccaacaccgaggagagaaaggaccgcaaggcctctccccgccctca agggtaacccttcttgtgcgcctcatcccattctgccattggactctgatttctgagggccaggagatttgggcaagttc cgattaaaatcaagaataaaaaatgtagag |
|
Protein
| Protein ID | habu1_s6078_g16671.t1 |
|---|---|
| Definition | - |
>habu1_s6078_g16671.t1 MLFSLRELVQWLGFAPFELLLQAAALLATSGLLALKADGAAAGLSWWGVFAPLFAADGLSTYFTAIVSVRLFQDGEKRLA VLRLFWILTLLSLKFVFEMLLCQKLGEQSHEPLWYGLIMSPVFILLQLLMIRACRVN |
|