Gene
| Gene Model ID | habu1_s6083_g16720 |
|---|---|
| Locus | habu1_scaffold6083 : 1 ... 8285 : - |
| To GenomeBrowser | habu1_scaffold6083:1..8285 |
| Genes list of scaffold | habu1_scaffold6083 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 0.0 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 4.1 |
| Nose | 0.0 |
| Brain-1 | 0.0 |
| Eye | 0.0 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.0 |
| Brain-2 | 0.0 |
| Spleen | 0.0 |
| Lung | 0.0 |
| Liver | 0.0 |
| Kidney | 0.0 |
| Pancreas | 0.0 |
| Small intestine | 0.0 |
| Large intestine | 0.0 |
| Stomach | 0.0 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 0.0 |
Transcript
| Transcript ID | habu1_s6083_g16720.t1 |
|---|---|
| Definition | - |
>habu1_s6083_g16720.t1 taagtcgaggactaaaccggtcataagttgaggactaaaccggtcataagtcgaggactacccaaccagtcgtaagtcaa ggactttccctgcccgggagcgccgcgcatgcgtggttccgccccctgcgctggccgaggcgtagctggcaagcggcaga gacggaacaggccgaccaccagctggcccagcccaagggag |
|
Protein
| Protein ID | habu1_s6083_g16720.t1 |
|---|---|
| Definition | - |
>habu1_s6083_g16720.t1 MRGSAPCAGRGVAGKRQRRNRPTTSWPSPRE |
|