Gene
| Gene Model ID | habu1_s6115_g16775 |
|---|---|
| Locus | habu1_scaffold6115 : 40083 ... 55065 : - |
| To GenomeBrowser | habu1_scaffold6115:40083..55065 |
| Genes list of scaffold | habu1_scaffold6115 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| breast cancer metastasis-suppressor 1-like protein | GO:0006351 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s6115_g16775.t1 | 1 | 1 | Sds3 | 57 | 196 | 1.49939e-42 | 145.4 | 1.4013e-45 | 2.90069e-42 | 144.5 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s6115_g16775.t1 | gi|637243766|ref|XP_008100981.1| | PREDICTED: breast cancer metastasis-suppressor 1-like protein isoform X2 [Anolis carolinensis] | 0.0 |
| habu1_s6115_g16775.t1 | gi|729769461|ref|XP_010581964.1| | PREDICTED: breast cancer metastasis-suppressor 1-like protein [Haliaeetus leucocephalus] | 0.0 |
| habu1_s6115_g16775.t1 | gi|224051440|ref|XP_002200556.1| | PREDICTED: breast cancer metastasis-suppressor 1-like protein [Taeniopygia guttata] | 0.0 |
| habu1_s6115_g16775.t1 | gi|56118992|ref|NP_001007936.1| | breast cancer metastasis-suppressor 1-like protein [Gallus gallus] | 0.0 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 4.7 |
| Venom grand-1 | 0.0 |
| Pit, infrared sensing | 3.0 |
| Nose | 2.3 |
| Brain-1 | 12.2 |
| Eye | 3.3 |
| fetal fibroblast | 13.5 |
| venom gland-2 | 2.7 |
| Brain-2 | 11.1 |
| Spleen | 4.7 |
| Lung | 1.8 |
| Liver | 2.7 |
| Kidney | 0.6 |
| Pancreas | 0.2 |
| Small intestine | 0.8 |
| Large intestine | 0.6 |
| Stomach | 0.6 |
| heart | 4.1 |
| ovary | 52.5 |
| cheek muscle | 5.0 |
Transcript
| Transcript ID | habu1_s6115_g16775.t1 |
|---|---|
| Definition | - |
>habu1_s6115_g16775.t1 ccggcgaagctgctgtcctggtctccagcgggtgacgccgggcgtctgccgagagcgggcgcgatgccggtccattcgag ggagaagaaagaaaacaaccacgatgatatggaggtggactacggggagaacgagggcagcagctccgaggaagaggagt ccgagagctcgtccgtctccgaggagggggacagctcagaaatggatgatgaagattgtgaaagaagaagaatggagtgt ttagatgagatgtctgatcttgaaaaacagtttacagatctcaaagatcaactttacaaagagaggttaagccaagtgga tgcaaagctacaggaagtcattgcaggaaaggcaccagagtacttggaaccattggcagctctgcaagaaaacatgcaaa tccgaacaaaagtggcgggtatctacagagaactctgcttggaatctgtgaaaaacaagtatgaatgtgaaatccaggct tcccgacagcattgtgagagtgaaaagctcttgttgtatgatactgttcagagtgaattagaagagaaaatcagacgact tgaagaagaccgacatagtattgacattacctcagagttatggaatgatgaacttcagtctaggaaaaaaagaaaggatc tatttagtccagagaagaaaaaacctgttgttgtatcggatatcctttaacagctgccataaatatacattcatcatgct attct |
|
Protein
| Protein ID | habu1_s6115_g16775.t1 |
|---|---|
| Definition | - |
>habu1_s6115_g16775.t1 MPVHSREKKENNHDDMEVDYGENEGSSSEEEESESSSVSEEGDSSEMDDEDCERRRMECLDEMSDLEKQFTDLKDQLYKE RLSQVDAKLQEVIAGKAPEYLEPLAALQENMQIRTKVAGIYRELCLESVKNKYECEIQASRQHCESEKLLLYDTVQSELE EKIRRLEEDRHSIDITSELWNDELQSRKKRKDLFSPEKKKPVVVSDIL |
|