Gene
| Gene Model ID | habu1_s7897_g18383 |
|---|---|
| Locus | habu1_scaffold7897 : 1819159 ... 1890680 : - |
| To GenomeBrowser | habu1_scaffold7897:1819159..1890680 |
| Genes list of scaffold | habu1_scaffold7897 |
Annotation by Blast2GO
| Annotation | GO |
|---|---|
| c-x-c motif chemokine 14 | GO:0005576 GO:0005794 GO:0006955 GO:0007165 GO:0008009 GO:0045662 GO:0048839 GO:0060326 |
Hmmer Search for Pfam
| query | Total | ID | Target | From | To | Eval | Score | cEval | iEval | Score |
|---|---|---|---|---|---|---|---|---|---|---|
| habu1_s7897_g18383.t1 | 1 | 1 | IL8 | 37 | 98 | 2.3e-11 | 43.5 | 2.3e-15 | 3.5e-11 | 42.9 |
Blast Hit to nr / sp
| query | Subject ID | Subject Name | evalue |
|---|---|---|---|
| habu1_s7897_g18383.t1 | gi|602633538|ref|XP_007423647.1| | PREDICTED: c-X-C motif chemokine 14 [Python bivittatus] | 0.0 |
| habu1_s7897_g18383.t1 | gi|327278470|ref|XP_003223985.1| | PREDICTED: C-X-C motif chemokine 14 [Anolis carolinensis] | 0.0 |
| habu1_s7897_g18383.t1 | gi|530645668|ref|XP_005309491.1| | PREDICTED: C-X-C motif chemokine 14 [Chrysemys picta bellii] | 2.94273e-44 |
| habu1_s7897_g18383.t1 | gi|558129919|ref|XP_006116095.1| | PREDICTED: c-X-C motif chemokine 14 [Pelodiscus sinensis] | 2.00386e-43 |
| habu1_s7897_g18383.t1 | gi|591357188|ref|XP_007053669.1| | PREDICTED: c-X-C motif chemokine 14 [Chelonia mydas] | 9.99995e-41 |
Expression profile
| Libraries | FPKM |
|---|---|
| >Adult | |
| Venom fang forming tissue | 26.9 |
| Venom grand-1 | 1.3 |
| Pit, infrared sensing | 2.8 |
| Nose | 16.0 |
| Brain-1 | 21.7 |
| Eye | 12.9 |
| fetal fibroblast | 0.0 |
| venom gland-2 | 0.2 |
| Brain-2 | 15.1 |
| Spleen | 0.0 |
| Lung | 0.5 |
| Liver | 1.4 |
| Kidney | 15.4 |
| Pancreas | 0.0 |
| Small intestine | 1.1 |
| Large intestine | 0.0 |
| Stomach | 0.2 |
| heart | 0.0 |
| ovary | 0.0 |
| cheek muscle | 0.4 |
Transcript
| Transcript ID | habu1_s7897_g18383.t1 |
|---|---|
| Definition | - |
>habu1_s7897_g18383.t1 ggccgaggcgtagctggcaagcggcagagatggagcaggccgaccaccagctggcccagcccaagggaggttgttttttc aacttcccagtccagctcttggattttctggtgatctcccacacaagcgtagaaggatcaaaatgcaaatgcttaagaaa gggtccgaaaataagattctctgacattcagaaacttgaagagcggccaaaatatccatattgcaaggaacgaatgatca tagtcacaatgaaatcacgtttccgaggtggccatcaatactgcttgcatcctaaactcccaagtacaaaaagattactt aagtggtatacaatatggaaagaaaaagaaagagtttatgaagagtaagagagtgatgtctaatagaagaagtgggattg attaattgatgggcataagaaagatggacaacaaagatgacttctcacaagacacaactcaacatctatgttaattataa agcacttttcttgttaccaagga |
|
Protein
| Protein ID | habu1_s7897_g18383.t1 |
|---|---|
| Definition | - |
>habu1_s7897_g18383.t1 MEQADHQLAQPKGGCFFNFPVQLLDFLVISHTSVEGSKCKCLRKGPKIRFSDIQKLEERPKYPYCKERMIIVTMKSRFRG GHQYCLHPKLPSTKRLLKWYTIWKEKERVYEE |
|